CAZyme Information: MGYG000002473_01878

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01878
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		86653.09	5.4324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 8345; End: 10636 Strand: +

Full Sequence      

MNTWNLNGAWRLKYRKPGDEWSEIPAEVPGNVELDLMRAGVLPDLTRGNNVYRALEFEEC
EWLYETVFRLDALPAERLRLVFDGIDCFATIRLNGVEAGRAANMLIAHAFDVTGLAVAGE
NRLEVAIAPAVAEGRRLPPSPSENAFPGNWESLRVRKAPHMYGWDIAPRLVSAGIWRGVR
LETVPATAFRDIYWATLEADPDSSRAKVLLAWDLIPGCAEWRKFRLSIRLSHDGETAFES
VRPLFSTHGKQVIELTDARFWWPRGSGRPDRYEAELRLFDESGRILAEDRQRIGIRTVRL
SRTAVTGGPGKGDFSFYVNDRRIYIKGSNWVPLDALHSRDAARLEETFAMALDLNCNMLR
CWGGNVYEDHAFFELCDANGVLVWQDFSLACFLYPQDREFCDAIRAEAEFIIRKLRNHPS
LALWAGNNEIDSAGFDWGPLKSDPNRWDKLSREVLAQAVQTFDPVRDYLPSSPYYAPELI
AEGAPHGRKPEDHLWGPRNDFKGDFYMKSNAHFVSEIGYHGCPSPASMRDMLDPEAVWPW
RENDQWLTRAVRPMPGEDGYNYRIPLMARQIAVLFDSEPQTLEEFCLASQISQAEADKFF
IEKWRSEKEWRGGLLWWNVRDCWPILSDAVVDWYGRRKLAYAYIKASQRDVCTIVTEAAQ
GVHRPVVVNDTSRPVSGVVTIRDGESGEVLLRADFSCAAGEPARLPGIPAPAAPALWLSE
TRLSGDAEVGRNHYIAGPRPFELPRFRRWLKLLGYAADGFERE

Enzyme Prediction     

No EC number prediction in MGYG000002473_01878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	657	5.3e-80	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.76e-61	6	663	15	644	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.29e-10	5	429	43	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.42e-09	64	432	69	420	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23305.1	1.66e-215	5	750	34	796
QNL40264.1	9.86e-210	5	757	28	798
QQR15691.1	1.97e-209	5	757	28	798
ANU59404.1	1.97e-209	5	757	28	798
QRM99259.1	3.94e-209	5	757	28	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.55e-98	1	679	24	683	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	1.33e-79	1	690	3	713	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.35e-79	1	690	3	713	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.75e-79	6	645	11	648	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.85e-79	6	645	13	650	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	6.86e-80	6	656	9	665	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q5B7W2	1.32e-76	6	641	9	646	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
B8NW36	2.32e-74	1	641	4	646	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1CGA8	2.36e-74	1	641	4	646	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	8.27e-74	5	641	8	644	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_01878.