CAZyme Information: MGYG000002473_01946

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01946
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1000		112281.06	6.8103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 14283; End: 17285 Strand: +

Full Sequence      

MRYSVVLFFSIGILNAAPLVDFGAVAPESIRLHTPGKREQAAGIDTFDRRKALRIDWNNA
RAGHFEFHTTDKLILPEFLKVKIRVQAYLPEHCKARSLNLRIVDRDGETFQVYRPLAGLK
PGWNEIIYELDSETPGAGSFGAGKKANRKIDFPARLGGFAADFNSKDGEGFLAIGTVEIE
IVSTRLPLRPVLETGTAVHVLTPENEAGILLANDRAVDVSGKLEFRVADVNGNPVCGEES
EVFLAPGESRRFPIVKPEKFGVYYVDVKYSEFEEHKKPFEKTFRFCYMKPAGPVPGPAKG
FLFGGCTHPLGKPVEDQKREALAAALCGIKVMRVDFYWESMQPTAQSELNFKRFDDALRV
FEEQGIEFQAIYCYLPKWAAAKDWKPLSMKFTGKPRPDYGLWRRFIRSAAGHYRGKLRYV
EVWNEPDHVGFANFSALEYIELMKIAYAETKRADPNMQVLTGGYTCMPNGFVKLVEKDHM
QRTLVEGRGAYDIFAFHGHGPFHDYRNQIDRLVKMKKELKVEAPWWANETAISSIHVGEL
GQGITLYRKLIYSWARGAMGYSWFNLRNNGFDPRENEHNFGLLTRDFYPKAAYGVYNTLA
RLFREAEYLGDADAGEGIDAFFFRDARGELLLPHWSGASSGSGRVLLLSGISGPVTRIDL
FGNEEVLPVCNDALVVEVGEIPATLRFAQRETPRICGEFFQLADDFICRPGGTGKYRFEL
MNPTGTSLTFRIEPELPEGLTLKEKILPLRIAPGQKKTVTLRIAADKNFRYLHNRQEMIG
IALAVDDLWEGVLHFKARCATPLNRGLSGRPDFVLESADQIVTLVANHPDSAHLFWKGGE
DLSAEVRLGHDGTALLLKVDVRDDIHCQPYRGGRMYQGDGIQFALQLPDQKGLWEIGLSR
RDDGENDVHLWHAPEGFDPSKTAAEIQLETLRDEAKKVTGYTVRIPFMTIGLNRNVGGGA
FRFNLLVNDNDGEGRESYIAIAPGIGESKTPDEYPVVIFH

Enzyme Prediction     

No EC number prediction in MGYG000002473_01946.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	337	628	4.2e-26	0.7215777262180975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.08e-77	811	999	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.13e-13	836	984	30	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	1.08e-11	834	980	10	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam11614	FixG_C	1.49e-05	716	768	33	85	IG-like fold at C-terminal of FixG, putative oxidoreductase. This domain is part of a transmembrane protein, FixG, itself part of the FixGHIS operon closely associated with the FixNOPQ operon that is the symbiotically essential cbb3-type haem-copper oxidase complex. FixG expression is induced by oxygen-deprivation. This C-terminal domain adopts an E-set Ig-like fold.
pfam01229	Glyco_hydro_39	2.90e-05	395	463	120	195	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	1.91e-265	40	999	70	1032
AHF90198.1	2.52e-261	37	1000	41	1006
AVM47149.1	9.04e-171	17	999	180	1306
AVM46276.1	6.53e-166	164	999	303	1136
AVM44759.1	7.58e-135	290	999	258	964

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000353	0.998956	0.000163	0.000182	0.000171	0.000152

TMHMM  Annotations     

start	end
5	27