CAZyme Information: MGYG000002473_02179

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_02179
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		66793.33	4.8066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 16946; End: 18715 Strand: +

Full Sequence      

MVKPMAWAGIEVRLEGECADWQVAAFMEEVESGIAEFHFQFSRPEPAVMPAFALRWEFPD
IDLQGRWSPLAFRSKLIPPNWGSREVSQLASGAPVMTLFNQAGENRLTFAFSDAMNQLEM
HCGVEERNSVMECALEAFRSPTAPVSGYECTLRLDIRPVRYERALNDVAAWWAEMPEYRP
SPVPAEAREVVYSSWYSYHQDLFAPELEAECRAAAGFGMKSIIVDDGWQTLDNHRGYAFC
GDWEVCQERFPDMAAHVRNVHASGLKYVLWYSMPWLGKKCRAFERFRDKTLFFEERLGAA
ALDPRFPEVRDYLIGLYEKALREWDLDGFKLDFIDTFEIRGEDPAVAENYAGRDFKSLPE
AVDVLLSETMRRLRAIKPEVMIEFRQRYIGPAMRKYGNMFRAADCPNDAVTNRVRTIDVR
MLAGDSAVHADMLMWNYAEPVETAALQLLNVLFSVPQVSVRLEAVPAEHRAMLRFYLGFW
REYRDVLLDGTLRADHPELDYPRVTAIRGRRQVTALYAQDQVVEFAPAPGDELCIVNASG
KSGVYLDLAEAPVAVELFSATGMALEIALPAAGPQRVGVPAAGLLRLRF

Enzyme Prediction     

No EC number prediction in MGYG000002473_02179.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.99e-62	187	482	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.39e-08	188	332	41	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	6.72e-08	222	336	37	154	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.59e-06	29	270	116	374	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	4.22e-05	192	286	5	98	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	2.72e-212	11	589	9	587
CQR57728.1	4.35e-203	13	588	12	588
QTH41069.1	5.63e-196	13	548	13	545
AIQ58516.1	6.90e-195	11	548	10	547
QSF42796.1	9.04e-192	1	588	1	589

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_02179.