CAZyme Information: MGYG000002473_02748

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_02748
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1009		111563	7.4518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 924; End: 3953 Strand: -

Full Sequence      

MNYWLLIPAVCGITLNAAVDFTGPGFPPLSLNRAGEAATVPVRQTVTVADFRDGFPDIVL
NKAGERGQKLIHAAERGALQVEWRRANAGYWEWSCRKPVPLPEFTSARIVVKLTAGSPEP
PEWFNLRLADATGEVFQYAKRTDWDRDGVCNLVFELERSQKPVLSWGGNGDGRLDFPVKF
LGASGDFKAGEGDGKLWIDSIRGEFVSSVPLSRAVAVTLKGTDPFHLIPPERQGPVLSFH
NRSVSAVRLNAELTLRDFDGMAVRKRFPLVLAAGETRPFVWPEKLGRRGIRYLECRFSDS
ENPGDSSVWNSSFAVMEPAGPTAGAGRGFIFGVCSHPNWTRDREVHRREAEAAALAGAGV
VRIDFEWWQIEPEKGKRDYTLYDELVETFAQRGVEFEAILGKPPKWAVVKGNLPDYGAWR
SFVRDAFRRYRGKIRLWEVWNEPDLAGFASFDVPEYVELMRIVREEADREIPGATVLSGG
FATMAAHGSKKREDFQEETLKRGRGLFDLHAYHEHGTFPQYRQLVDGLFLPMRKRAGVAV
PWYANETAITSAGVGEREQAVTLAKKLVFAWSRGAVGYNWYNLRNKGDDPRDGEHNYGMM
TSDFRPKAVYVAFNTLAGLLRGHGFVRQIPVADGGMLFEFRNGTERVLCGWNEEFRSAGK
RLLVDSDAVRAELIDLMGNAVPAERLGDRLLLPLERTPAFLRLAGADRVEVAGGVMRIIP
PPVAVSGRTLPLEIELVSPVSRPVNAKLTLLPPAGLRTENDQVELVLGPGKRCVWKTQLS
VGGDFLPKLGETETVAVECRIPELGYRDRLEQPVVGALPLPARFDLNRKNQTVSLFDADP
TKTALVWSGPGDLSAEVRLDASDRELLLRVDVTDDRHCQPFWRSDMWQGDGVQFALAVPG
QQGLWELGLSLSDSGGSKCFAWSVPNGFDRTAAAAAMRLEAERRGTVTHYRAAIPLAALG
LDRTKLREGIRFNLLVNDNDGEARKGWIAAAPGIGSGKDAGKYPVVVGP

Enzyme Prediction     

No EC number prediction in MGYG000002473_02748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	374	626	3e-18	0.6728538283062645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	3.25e-69	824	1007	3	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	1.90e-10	838	989	3	157	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	3.86e-07	846	993	29	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam02449	Glyco_hydro_42	0.005	360	434	26	115	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	3.58e-200	72	1007	208	1305
AVM46276.1	5.69e-186	68	1007	34	1135
AHF94342.1	1.50e-163	69	1007	73	1031
AVM44759.1	9.54e-159	241	1007	185	963
AHF90198.1	1.18e-150	78	1006	56	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	2.97e-20	289	701	69	496	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
6LVW_A	6.29e-06	332	450	4	139	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.824137	0.154623	0.020833	0.000137	0.000092	0.000179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_02748.