CAZyme Information: MGYG000002473_02943

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_02943
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652		74490.71	9.2244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 766; End: 2724 Strand: +

Full Sequence      

MKRLLLAALLTFAAGSFAAEATPQWPFDRRAPEELRKMERKVFAHYFSQFPVSIDDGNPD
GDYYAKGYLSPDGENGIHRPYGRFINQRPLPRLPRLVPDWHELDVYDEVRMAAETGMDGF
AYNILTTTGSHWKRLLTLMNQVNKYGKGFKILIMPDMTAEFSEHPERMVPALLKIAGDPS
LYRDGSGKLVIAPYNAYAQPPQWWKERLAELKSHGVDVVFMPGFQGWWKYLKDYRELCWG
FFDWGTSALDEQLGWRRQALRETDRYGKVFMAPVRPQDCRPRAGMAGEAHNSELFRAMWQ
TAIDYNAGWVQLVTWSDYSEGTEIAPSTGTRWAFYDLTAYYTSYFKTGKPPKIERDAIYW
FHRRQHTDAPYDKTQQTRGPFRIVGTPHNEIELLGFLKAPGTLRITLNGKVHEQAFPAGM
HSFKIPLECGRPEFSLIRDGRELIRLTGHQEIVRSNPYQDMLYYADGGTAEAPRIWTGPE
KKTVAPEFGKLIRQVSFPGFPLVSGKGGKPREVGFGGSFRIPDESEAVFHVRRMDVKADH
GWVALFLSAATTDGRSRFNLTPRTAKQTYISGSHPGTPFRVVRDNFQVEYPAIYRLRRTG
GKLQFLYGNYVVAEVDEKEYGKLDRPSISISAEKPEDGGLLEFSAIELRRLP

Enzyme Prediction     

No EC number prediction in MGYG000002473_02943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	100	445	9.8e-51	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11577	GH71	1.12e-44	99	363	23	282	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
pfam03659	Glyco_hydro_71	3.27e-21	99	444	17	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
cd11573	GH99_GH71_like	7.00e-07	99	328	6	255	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
cd11575	GH99_GH71_like_3	1.08e-06	39	331	6	316	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.
cd11574	GH99	6.94e-05	155	327	87	308	Glycoside hydrolase family 99, an endo-alpha-1,2-mannosidase. This family of glycoside hydrolases 99 (following the CAZY nomenclature) includes endo-alpha-1,2-mannosidase (EC 3.2.1.130), which is an important membrane-associated eukaryotic enzyme involved in the maturation of N-linked glycans. Specifically, it cleaves mannoside linkages internal to N-linked glycan chains by hydrolyzing an alpha-1,2-mannosidic bond between a glucose-substituted mannose and the remainder of the chain. The biological function and significance of the soluble bacterial orthologs, which may have obtained the genes via horizontal transfer, is not clear.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT69481.1	3.17e-104	15	475	70	532
AYV26581.1	7.37e-97	26	465	116	558
AKL65161.1	1.03e-96	26	465	116	558
QNT70161.1	1.70e-95	16	469	37	508
QES52163.1	3.01e-95	35	465	7	437

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.998968	0.000185	0.000184	0.000181	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_02943.