CAZyme Information: MGYG000002473_03020

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_03020
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MGYG000002473_165|CGC1	59675.71	9.0725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 1659; End: 3239 Strand: +

Full Sequence      

MKKLILQLLLLAVVCLYCSASMVDLLRVRLGKLPEQDFARIEATDFGDALVVTVPENRKQ
GSHWIMMKQLDLKPFRGKKLLFTVFVKGENIARAPAYYLGLKYMFAVRTETGKSYPQAPG
LAGTFDWRKLSFEVQVPQDAISGELVAGLQETSGKVWFRNFMISQGGFLKPPVELPPGFR
CEYTPEFLARPITRGVMSPDPLKVTEKDVDDLGSWGATNIRWQLKGSNEQAVDLEVYNNL
IDRQLNRLEELLPAFERNGIHIIIDMHLLPGGRIDYAGPLGTAGEEAVAAYGNAAANRAL
GVEKYYRAYLDTWRKIARRFKPYPIVMGYDLFNEPVQSCEMPHDYLSIQYDAARAIREID
PERMIVISPNNWGGPGGFAGLTPLPLKNLVYQTHFYDPGTYTHQGIFKNARMGTRYPGMI
DGVYADKKLLKKYLKPVVEFQKKYGARIYCGEFSVARYAPGGAQYLKDVISIFEEYGWDW
SYHAFRESHYWSVEHAGPDGAHPVPARDTDRKRVLLEAFRKNGERK

Enzyme Prediction     

No EC number prediction in MGYG000002473_03020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	204	488	5.5e-41	0.730909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.45e-21	203	404	23	203	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.20e-11	203	495	73	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44501.1	1.69e-125	32	522	39	503
AVM45838.1	5.26e-123	32	522	53	529
AVM43397.1	1.76e-116	53	522	54	507
AVM43398.1	6.52e-113	53	522	55	510
AVM46198.1	1.23e-109	50	522	41	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.37e-20	204	482	29	315	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.36e-20	204	482	29	315	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	2.32e-17	240	485	68	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3NCO_A	3.24e-17	303	485	113	295	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	3.24e-17	303	485	113	295	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	9.12e-21	204	482	29	315	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	9.12e-21	204	482	29	315	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P23340	9.12e-21	204	482	29	315	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.068816	0.927231	0.002984	0.000309	0.000284	0.000326

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_03020.