CAZyme Information: MGYG000002473_03320

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_03320
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		70566.37	8.1215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 2586; End: 4514 Strand: -

Full Sequence      

MDVFGRNGVELQCLLGYSVPWAVPASYKPKNPEVKGRPGLPDYDDFAKFAGTVADRYKDR
IRYFEIWNEPDLIGFANFSAESYMELLRRGYGAVKKAAPEAKVMNGGIAAVHTNNSGRPN
HNNGLFELLLADGGKHFDLFAFHGHGAFKPYVGQLRELRKYGLTGPGAPRPWYSNETAES
SAAIGERKQAASVFKKLLYAWANGAMGYNWYLLREKSYYPLGHHERHFGLITAEFEPKPA
YVTYNMLANTYKGGKFLRTVDLAPSVYGCLFENPAGQGLLALWNEGTARTVLLAGLPAGT
TRIDLFGNEQPLPVRDGMAYLRISEQPFTLRMPEVPEEKIRIGGEVLTGRLPQQLAVPSG
GTGELALQLANPLSRPLALEIRAAAPEHLTVAPAAHAVTLPAKGDATVRLRLTADREFKA
TPTAPALFRFSVTPAGLSPETITLPVVNRLPEGEPLFRLGKAEQYHSFVESAPGNEPLYW
KGPEDLGANVFLSCEGKHLLLRAEVRDDVHVQPYRGSDVWQGDGIQFALRLPGQDKLWKF
GLTRLADGKPEVYCWSRPAGFSGTVSSIRLETARDEVKKTTVYRAEIPFRAIGMTPENAA
NGFRFNLIVNDNDGNLREGFLAAAPGLGVGDDEAAWPIVNLR

Enzyme Prediction     

No EC number prediction in MGYG000002473_03320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	42	285	2.4e-25	0.605568445475638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.75e-74	455	641	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.41e-12	480	636	30	180	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	2.59e-08	480	620	12	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG2723	BglB	0.003	44	78	143	177	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	1.41e-149	1	639	385	1030
AHF90198.1	2.02e-125	1	642	372	1006
AVM44759.1	7.50e-122	1	639	326	962
AVM46276.1	1.47e-110	1	639	499	1134
AVM47149.1	1.67e-109	1	639	663	1304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_03320.