CAZyme Information: MGYG000002473_03339

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_03339
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
974		108083.01	6.8275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 789; End: 3713 Strand: +

Full Sequence      

MRLIFCLAAVLLLALSTAAGDTAPGFVRIRQQLPLTAETWKPVFYEGTGRAGFGGNGVTL
ALDCKAAALFPRRPLPEVTGPRRFTVQAELLDGTAEIRFLVVGRDGREFRFPWRALKPGK
NTVAFPFDGEAAAVEPPLRLTGVSVRTGGKATLRLEQAELESDEPEISRIELSYDRAYPI
NIETPDGKHPVALLLRNPLASAVKAMWKLELREPGKEPVRQEGVRELPPGETVRLPLPPA
ERNGIRYGTLELAAAALPEIVRRESFSVARMNPAGPTPGRAEGFLFGVCGHPQRYPAEDQ
RREAAAAALCGAKVLREDAGWGRIQPSREAWNFDSLDETVRIFGEQGIELELIYSYTPAW
AVAADWKPLNEQRRRVHNSRPDYEAWREFVKRTAARYRDQIRFFEVWNEPDLFSFANFTA
EEYLRMLKIAGEETHKAAPGALVLTGGYTCMPPYFALNDQKHQEKTLADGRGYYDIHAFH
GHGPLEHYAPQIERMIAMRERLGVAAPWWANETAETSVFVGEAGQAATLWKKLFFSWANG
SIGYNWYDLRNDGFDPRNVENNFGMITHDFFPKAIYPAYNTIVRNFRGTEFDRALDRFPA
LRLYRFQKGKRRLLAGWNDSPDSGTRLIAFTAGAGKGERFDLFDNRSPLAVAGGTVLIPV
GREPAGVELSGGGWEPLCEPVLPLGPATLRRGGNPLTLQLENPFDVPTEMRLAFRLPAGN
AHPAETVRLAPREKRRVTVEFAAAENVPAENPGIAIDMRLGGLAGTLTLPVRPSAAIGPE
FSAGPDFRLDRPEQLTVLVPADPGKVRFFWQGPQDLSAALFLAMRDGVLKLRAEVTDDIH
CQPFRGEAVWQGDNIQFALAVPGQKTVWTFGLTRLADGVSECHVWDAPKGFDSKAVAAEM
RLETSRDEVKKLTVYEAELPLSAIGADSAKRKQGIRFNLLVNDNDGEMRESYLALTPGLG
EGRRPDAYYLLSFQ

Enzyme Prediction     

No EC number prediction in MGYG000002473_03339.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	330	581	6.4e-20	0.6403712296983759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.33e-73	785	973	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.49e-08	810	946	30	162	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.14e-08	799	952	1	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	7.53e-06	382	439	123	189	Glycosyl hydrolases family 39.
smart00633	Glyco_10	6.91e-04	321	410	3	86	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	8.22e-200	134	973	179	1032
AHF90198.1	2.08e-172	159	973	185	1005
AVM44759.1	4.66e-165	38	973	31	964
AVM47149.1	1.09e-157	47	974	365	1307
AVM46276.1	8.39e-155	81	974	237	1137

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.79e-11	287	697	107	522	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
6LVW_A	3.75e-09	287	399	4	130	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9LW38	2.05e-08	287	399	4	130	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999148	0.000152	0.000150	0.000136	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_03339.