CAZyme Information: MGYG000002473_03470

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_03470
• CAZy Family: GH167
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1028		115056.51	7.4807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 25; End: 3111 Strand: -

Full Sequence      

MLIVEDTAGKILIDEISITEEGNAVVSPAEFQRERVCVVPEFSGELSKLRTIPAGVPVMK
IPSSPEFSGTGAMPDPKRFSAEAALMHNERGLIFLVEVKDSSPNPGEGELMWKNDSVQIR
LDQAGLANDRANESDLEFGVSVGKTGTIRTWNYSGGGELPADSSQWFGHRGRDGYFIAGV
IGWNYLAALKPPYFTFNVVVNDLNANKRRDVYFLTPGLHDAKYSTQYVKALLDTGHPVLG
ASPANLLSTDAFTGTLVGANLKAPLRLEAAVTDGAGRVHLVPLREIPKTGAGDMIKLEYA
IPAGNLADGECRIEFRANGEPLAGYAVKKADLIKQQSARLDAALRRLETLRRELANEKSE
YVRLPLNVLGDFLPRFRERMDRAGDKRLHAERLLMVMPDAEAALDDLERLAGELKRGRKL
PVTWRYIPGPIRLAEGWPKAKLQSSDGRVEERDVVFVGYGHFANMRRDFPNFPKYGANVI
QIERGPRSLYPRRGEKREFDPDFSDLEREFGPMLAESWANGMPVVLLISPHYSPEWWEKA
HPEAKLASGFLKYNIAHPEARRMMKAYIRDFLGRLRQQPYAAAIHSICILNEPTFTGTLQ
EPFLRGEFRKYLEKKFGSVAAFNRAAGGEFPSFDAVVEAGVKNPAVDAEFALYRRSEMKN
WAKFLADEVRAVWPGMPVHAKIMIMNSTFDKSHAIDPEMFAEFSDYNGNDNYGNYKEGGY
LSDWVQFALGHELQFSMKPASIVNAENHIIRDSERRPIPNDHIYTVNFQQHVTGASALVT
WVWVDYSPESARNTHKDLQGNIALRPGNVIAQGIAALDAVRLAGELKAFTAYEPEIAILY
SPTSTAFNPALLKNELFKFYAQSAFTGHRLRFLSEKQLVDGKLGKTRLLFVIGSANVSRV
AADALAKFPGKVVADRHSLRFDEFNRPLKLAFRPEILPDFIKAPELKKRYFDPVVPLPVE
LEGDCDGIFFRVVPDGRGGRLVNLVNYTEAPRKLRLKSELAFFDLIREEAFDNEFELPPL
KPLLLRAK

Enzyme Prediction     

No EC number prediction in MGYG000002473_03470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH167	438	1026	2.1e-112	0.8521617852161785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.60e-10	76	227	25	183	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	2.18e-09	74	209	13	153	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	3.65e-07	80	211	37	168	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
pfam06452	CBM9_1	0.001	70	210	22	157	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
pfam02449	Glyco_hydro_42	0.002	502	738	45	288	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43323.1	8.14e-278	1	1026	308	1355
AVM46829.1	4.98e-198	2	1026	147	1179
AVM43886.1	1.54e-126	250	1028	207	999
QGQ94885.1	1.43e-74	80	941	685	1543
AZN41326.1	1.04e-69	80	937	515	1369

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_03470.