CAZyme Information: MGYG000002473_03562

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_03562
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664		73682.37	8.9165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 236; End: 2230 Strand: -

Full Sequence      

MTTTIRQYTSALLLAAAIVPFTGRAAEAEEFLLGATVHFTQDKGILDVNLKLARDCNLNA
IREDLPWKLAERRRGIVTAPSLFRRIADTARANGLPVLGILAYNNHFYDGGSYPRSAEAV
AAYARYAGQVAAGLRGRGVPFYQVWNEWDGGCGMNPAKRGRGDAESYINLLKAAYPALKQ
ADPDATVVSGSVCTGDEYFEKLLQLGIADHCDILSIHTYNFQQRGEAATPEAWQRRMLKL
DEMIRKYNNGDSKPVFVTEMGYPSFTGPHGRTAGECAVYLARLMLLARTVPNLRGLWWYD
LQDDGWDITEREHNFGLFNADGTPKPAAAVMRDLAPLVRKGEFLGRLDTGDPSVWILRFR
HDGRETQAMWSTGGRRSGLVWEKGPGSTGTFKMRRPGQPPQPLAWGRRDWVADRKAKFDP
ARREITIDEMPLLMTGDFTDVRLAGTVERPAPPAGRSDYRLPPDIAVAVPKGEKAAAVSL
PKRGNYFKFADPGYQGDKDLDAAFEFHYDRDHLYLTVRTVDDHFRLAPSAERGWGSDGIQ
TGFHFDREGGSPLERVELDFALTGHGPEACWRTPFAGRRPGIATDVKITVREGKREGTAR
WHTYRLTIPASSLGAGELRPGRSFLFSILVNDNDGAGRKGFLHWGGGLGSRPYDPSFYNL
VVLK

Enzyme Prediction     

No EC number prediction in MGYG000002473_03562.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	117	359	2.1e-29	0.5823665893271461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	7.55e-51	476	663	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd00241	DOMON_like	3.06e-06	496	644	14	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam01229	Glyco_hydro_39	3.43e-05	141	372	151	384	Glycosyl hydrolases family 39.
cd19608	GH113_mannanase-like	4.54e-05	226	333	199	308	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
pfam07745	Glyco_hydro_53	0.001	86	331	63	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46868.1	4.30e-141	13	664	5	641
QCQ20833.1	8.83e-77	25	381	35	387
AFN77449.1	1.35e-62	29	385	30	382
QKZ07105.1	6.71e-62	22	435	18	424
QQN51083.1	1.24e-61	13	373	8	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.55e-24	33	372	106	448	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
6GVB_A	4.24e-09	215	377	213	363	ChainA, exo-beta-1,4-mannosidase [Cutibacterium acnes],6GVB_B Chain B, exo-beta-1,4-mannosidase [Cutibacterium acnes],6GVB_C Chain C, exo-beta-1,4-mannosidase [Cutibacterium acnes],6GVB_D Chain D, exo-beta-1,4-mannosidase [Cutibacterium acnes]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000423	0.998623	0.000259	0.000247	0.000234	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_03562.