CAZyme Information: MGYG000002474_00607

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_00607
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000002474_2|CGC2	72765.46	9.1435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 90529; End: 92457 Strand: +

Full Sequence      

MVKVDKWHSLALSVLLVTASGVAKADSLDAQRQHYMQIKQAWDNNQMDVVSQLMPTLEDY
PLYPYLEYRQLTQELGDATPAQVNAFVKANPTLPPARSLPARFVNELARRQDWNSLLSFS
PQPPKPVAARCNYYYAKWATGDQKTAFDGAKDIWLTGTSLPNTCDKLFSVWQGAGNQTAL
TTLQRIGLAMKAGNTSLVSYLAKQLPPDYQTMRDALVDLQNNPNTLESFARNVGPTDFTR
NATSITFARIARDDSENARSMIPVLVRLQKMSDSDRLELEEAVAWRYMGSDATPEQAAWR
DNVILRSHSTTLVERRIRMALAAGDRQGLNQWLQRLPSDALQEDEWQYWRASVMIDNGQR
SQGEAMLRTLMKGRGFYPMAAAQKLNVTYPMQISVAAKPDSSIAKLPEVARVRELMYWQM
DNLARTEWSYLVSSRTESQQSALARYAFEQKWPDLSVQATITGKLWDYLEERFPLAWPDE
FRRATNDKGITQSYAMAIARQESAWNPKARSPVGAAGLMQVMPATAQHTVDMFGLQGYSN
PGQLLDPQMNITIGTSYLEYVYQMFGRNRILSSAAYNAGPSRVNTWLGNSAGRVDSVAFI
ESIPFSETRRYVKNVLAYDAFYRYFLHQPAKILTDAEWQRRY

Enzyme Prediction     

No EC number prediction in MGYG000002474_00607.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	494	618	2.8e-29	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	642	3	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	2.37e-64	472	624	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.89e-47	344	635	1	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	7.41e-39	496	618	23	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	8.58e-35	481	593	1	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA08694.1	0.0	1	642	1	642
AZP52628.1	0.0	1	642	1	642
QBJ09125.1	0.0	1	642	1	642
AZP48176.1	0.0	1	642	1	642
ADW75396.1	0.0	1	642	1	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.15e-292	26	642	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	3.81e-291	26	642	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	5.77e-86	12	642	9	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	4.14e-84	31	642	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.22e-83	31	642	1	609	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	8.59e-299	7	642	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	8.59e-299	7	642	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.10e-294	7	642	9	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	8.79e-65	222	642	175	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.69e-16	482	615	65	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000327	0.998903	0.000228	0.000184	0.000168	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_00607.