CAZyme Information: MGYG000002474_01457

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_01457
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1018	MGYG000002474_5|CGC3	116579.94	5.5259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 181890; End: 184946 Strand: -

Full Sequence      

MNNWENIDKQSENRLPPRASFFSYENPQDALRFDRAASQYFQLLSGSWQFRFFEHPALVP
EEFYRQPMTDWGKITVPGMWQMEGHGQLQYTDEGFPFPIDVPYVPTNNPTGAYQQRFTLD
AAWTGKQTLIKFDGVETYFEVYVNGHYVGFSKGSRLCAEFDISACVAPGENLLSVRVLQW
ADSTYIEDQDMWWMAGIFRDVYLTGRDAVHLNDFTVVTAFDENYCDAVLNINAIFGNSRK
PVSGYRLHAQLFDDGVCVAELSAENLNIGDETRCRLDIPVSHPRQWNAEHPELYQLLLTL
YNDAGQVICVVPQRVGFRDICVRDGLFYINGRYLKLHGVNRHDHDHRKGRAVDMARVERD
IILMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDLESHGFANVGDLSRITDDPRW
EHAYVERIGRHVMAQKNHPSIIMWSLGNESGYGCNIRAMAKRCIALDPTRLIHYEEDRDA
EVTDVISTMYSRVQMMNAFGEYPHAKPRIICEYAHAMGNGPGGLAEYQAVLNRHDSLQGH
YIWEWCDHGLLETGVNGQTRYTYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLREYKQVLC
PVGVSLSGGALRIKNRYWFSSLKDITLSLTVQVAGHCLETREISLPHLQPGECETLDLPE
FSASGQEVFLNIGIRKNSATAYSEAQHSLGHYQMLLQAALPSAVKPAPQKAATLLCDEQK
HQLIISGEGFRLAFSRLDGELKSWQVDNQEITGRAPTLNFFKPVIDNHKQEFEGLWQPNH
LHIMQQHFRQIRWERQQDDVVIEVHSIIAPPVFDFGMRCTYRWRISPQGVVTLDLSGTPY
GNFDSIIPKIGLDFGVSRRFTQVEYYGRGPDENYQDSCQANLIGHYQQPVNRLFENYPMP
QDNGNRQDIRWLSLRDDAGKGIFIQPRQPLNFSLWPYSSQMLQQAQHIDELMPDSCLTLN
LDHKISGLGSNSWGSEVLDSYRVYFSTFSYGFTMVPFSQKDTDSLHLAEFTFHSGEEN

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	883	6.6e-206	0.9694148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	38	885	9	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	2	993	15	1023	beta-galactosidase.
PRK10340	ebgA	0.0	1	1012	1	1015	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.25e-129	322	602	3	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	6.64e-108	726	994	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP40440.1	0.0	1	1018	1	1018
AZP44782.1	0.0	1	1018	1	1018
QBJ09680.1	0.0	1	1018	1	1018
ADW71766.1	0.0	1	1018	1	1018
AFE56405.1	0.0	1	1018	1	1018

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	2.98e-197	4	994	4	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.06e-197	4	994	5	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3OB8_A	2.84e-181	3	994	15	1029	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
1JZ7_A	1.67e-176	4	990	16	1016	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	1.67e-176	4	990	16	1016	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06864	0.0	1	1015	1	1018	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	1.68e-196	4	994	5	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	3.02e-189	13	996	30	1033	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A3FEW8	2.56e-185	4	993	18	1024	Beta-galactosidase OS=Enterobacter agglomerans OX=549 GN=lacZ PE=1 SV=2
A4W7D2	1.41e-184	4	993	18	1024	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_01457.