CAZyme Information: MGYG000002474_01460

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_01460
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793	MGYG000002474_5|CGC3	88557.49	6.3764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 187356; End: 189737 Strand: +

Full Sequence      

MKHINPHRPLSLLICAALFISGHALAETANSLRADSFKNVINRTGAPQYMLDYDFDEHQR
FNPLFDDGAWHGHLLPAGPEGMGGFPGPALLTEEYINFMADNFDRLTVYKAGQKVALSMN
AYSIPGALIQTLTAPGIRIDMTLRFVTSRTSLLETQITTDSPLELVWDGELLEKLRAQEG
KPPSDKTIEQEYPGYTRQILQAADGLRVTFGKVREASSLMTSGESEYQIHKTLPMQTEIN
GHRFTGKAKISGSTTIYTTYSHLLTAAEVQKEQPKIRDILAHPQPYLDASQKRWEGYLNT
GLTNPKATKDQERVAVKAIETLTGNWRGAAGAMKFDSVTPSVTGRWFSGNQTWPWDTWKQ
AYAMAHFNPDVAKDNIRAVFAFQIQPGDVVRPWDAGFVPDLIAYNPGPERGGDGTNWNER
NTKPSLAAWSVMEIYKTTGDKQWLAQMYPKLVAYHDWWLRNRDNNHNGVPEYGATRDKAH
NTADGKMLFTVREGQKEQTESGLKNYDRVVKSGQYDSIEIPAQVAASWESGRDDAAAFGF
IDADQLAKYIKNGGKKQDWQVKFAENRSDDGTLLGYSLLQESVDEASYMYSDNKYMAEIA
DILGKKTEAADFRAKAVKLAGYINTCMFDSRSGFFYDIRIEGKPLANGCAGKPITERGKG
PEGWSPLFNGAATQAHADAVVKVMKDVREFNTYVPLGTAALTNPAFGADIYWRGRVWVDQ
LYFGLKGMEQYGYREDAVKMAQAFFDHADGLVSDAPIRENYNPLNGQQQGAPNFSWSAAH
LYMLYNDFFGQGK

Enzyme Prediction     

No EC number prediction in MGYG000002474_01460.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	11	789	9.4e-252	0.9859649122807017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	9	790	5	785	alpha-glucosidase; Provisional
pfam01204	Trehalase	6.40e-05	583	790	305	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	0.002	424	703	205	451	alpha,alpha-trehalase
pfam17389	Bac_rhamnosid6H	0.005	588	703	174	274	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN34171.1	0.0	1	793	1	793
QBJ09677.1	0.0	1	793	1	793
AFE56408.1	0.0	1	793	1	793
AZP40443.1	0.0	1	793	1	793
AZP44785.1	0.0	1	793	1	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D3I_A	0.0	34	789	3	758	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
3W7S_A	0.0	34	789	2	757	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	0.0	34	789	2	757	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	0.0	34	789	2	757	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
7PQQ_B	1.51e-256	34	493	328	787	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	0.0	25	789	16	780	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.04e-15	353	779	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.38e-15	353	779	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.998595	0.000351	0.000229	0.000194	0.000179

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_01460.