CAZyme Information: MGYG000002474_01608

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_01608
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
990	MGYG000002474_6|CGC1	111495.61	4.9114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 105723; End: 108695 Strand: -

Full Sequence      

MSKKPENIKMWAATPAVNWESEAYPIGNARLGAMLFSDPLRDQIQFNENSLWGGLNNYDS
QNYDTSVTGFGSYLNFGNLHISFVEEAEVTYESPHGTMSANETVDKSVDGNKSTKWCIAS
PGNSVIWQAKNEEEKSIASYTLTSANDTPERDPSRWIFSASHDALSWIALDERTSVVFEQ
RLMSKTFTFINTVPYLYYRFEFIPIQGVSHFQVAEISLPDIILRPQTACYLTSPSGDSLG
SRTGGQGIIHCCDGDVKTKWCVEAPADEVIWEIQFPTATLFTSYELTSANDYPERDPRYW
TLSASNDGEIWTVLDAQPLDVHFTERLQTKTFPITNTQPWTFYRLTFSDTQLATHFQIAE
INLKGVEIDLRNYISIADYRRETDMITGVHTTTYALGNNLITRECFASHAEDIIVLHYSS
NNPGAFSGKLKLISGQETNTLSSGDKLTFSGILPNNLRYAAGIKVTHQGGQLTTQDNHII
VLNCDSLTIFMDARTDFAANFETNWRNGEDPAAKVASHLAQTSTVDFNSLRSRHIEDFSS
LMERVIVDWGTTDEQVKSLPTSRRLLRYATSHNDPELEQMLFYYGRYLLVSASRAGGLPA
NLQGLWNNSNTPAWASDYHNNINIQMNYWPAEVANLSECHVPLMDFIVNSRTSCRMATQK
QFGADIPGWTARTSQSVFGGNGWDWNVVASAWYMQHVAEHYAFTQDVTFLRDTGYPLIKE
ICQFWQARLILRNDGKLVSPKGWSPEHGPVEDGVMYDQQIIWDLFQHYLDAEDILNLDPQ
YRATIASLQANLAPNLIGSWGQLQEWQEDIDDPNDTHRHTSHLFAVFPGRQIIAGRDQDF
ADAAMVSLKARCNEKEGVPFTAATVVGDSRRSWTWPWRAALFARLQDGERAGIMLQGLLT
YNTLPNLFTNHPPFQIDGNYGITAAICEMLLQSVGNGEWDNINVIPAIPDAWKKKGSFSG
LCARGGYTIDCEWNNAQQSLIKTGRKKRLE

Enzyme Prediction     

No EC number prediction in MGYG000002474_01608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	366	977	2.6e-207	0.8227146814404432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.89e-24	368	499	96	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam14498	Glyco_hyd_65N_2	4.21e-17	10	127	1	143	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam00754	F5_F8_type_C	0.002	253	333	19	100	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXL96432.1	0.0	7	975	10	976
AXE83696.1	0.0	13	982	61	1036
QJT06140.1	0.0	13	977	61	1036
QQM45675.1	0.0	13	977	61	1045
QCD54033.1	0.0	13	977	61	1036

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	7.37e-98	368	990	141	756	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	5.05e-93	379	982	112	739	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	1.31e-87	352	975	105	723	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAB_A	1.64e-75	372	987	149	843	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.06e-74	372	987	149	843	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2R797	2.61e-87	363	976	121	759	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q8L7W8	1.26e-85	358	973	144	792	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
Q5AU81	1.30e-73	363	974	126	776	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	4.52e-52	362	975	114	696	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2
Q9FGY9	2.13e-08	253	363	600	716	Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Arabidopsis thaliana OX=3702 GN=PNG1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998591	0.001341	0.000051	0.000007	0.000003	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_01608.