CAZyme Information: MGYG000002474_02755

Basic Information

• Species: Rahnella variigena
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Rahnella; Rahnella variigena
• CAZyme ID: MGYG000002474_02755
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180		20245.39	10.088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002474	3995023	Isolate	Australia	Oceania

• Gene Location: Start: 84639; End: 85181 Strand: +

Full Sequence      

MKWLALFTLAAVFSAQASPEMCFNKAGRDYGIDPLLLTAISIKESRLRMDAINDRNRNKT
EDVCGMQVNSSHYPALRKFDITRERLLKEPCTCIYTGAWVLAHNFRAYGKNWDSVGMYNT
GPSPKLIVQRRAYASAIKNIYRILLATQMIQNKQIASSGETPLLAKSLASTNTDTKANYK

Enzyme Prediction     

No EC number prediction in MGYG000002474_02755.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	4.16e-46	30	142	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	3.67e-33	1	156	1	155	type III secretion system invasion protein IagB.
PRK13722	PRK13722	3.53e-25	22	173	22	165	lytic transglycosylase; Provisional
pfam01464	SLT	5.99e-16	23	140	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	7.75e-06	23	123	143	242	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT18149.1	4.97e-114	1	178	1	178
QMV54168.1	1.76e-90	1	154	1	154
QKJ89315.1	3.15e-85	1	156	1	156
QEW34544.1	1.68e-80	1	164	1	163
QBR48517.1	1.68e-80	1	158	1	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.85e-13	22	106	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17738	6.62e-25	2	141	3	142	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P14499	1.32e-24	2	141	3	142	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	2.62e-24	2	141	3	142	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
Q00739	3.69e-24	2	141	3	142	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
E1WAC2	7.82e-21	22	142	21	140	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999113	0.000161	0.000148	0.000147	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002474_02755.