CAZyme Information: MGYG000002475_00103

Basic Information

• Species: Lactonifactor longoviformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor longoviformis
• CAZyme ID: MGYG000002475_00103
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		45801.82	4.2111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002475	4812037	Isolate	Germany	Europe

• Gene Location: Start: 29013; End: 30269 Strand: -

Full Sequence      

MNGTKKRYLCHLLTASMVLAAPVSVLGAKSPAQSLLSPYQASLPSPLMPDAGSETASGTN
GWTKEGDSWYYYINDEKKTGWQKINEIWYYLGDTGSMAEGWTLIDDTWYYFTPGNGSMAT
GWQFIDNSWYCMDADGAWNENPEINTSGGWSFHDGYWYYNNLNGSPIKGWLKVDNKQYYF
DETGRMTTGWLTLEGKRYYLGEDGVMVTGEQVIDGTNYTFSTAGVCSQEVTSYESNVDAA
SGMYIIEGATSVTVDQMVNYFKANGASYPSAVLANGGAPDIETFSEIIYEEAAAENIKAE
VVFTQIMKETGWLNYGGDVSIGQYNFAGLGATGGGVPGVAFSDVRTGLRAQIQHLKAYAS
TAALNQPCVDPRFNYVTRNTSPYVEWLGIPDNPYGGGWAAGQNYGSSLIKMIQDLKSM

Enzyme Prediction     

No EC number prediction in MGYG000002475_00103.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	287	414	3.3e-17	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.42e-39	38	218	426	593	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	4.96e-37	46	224	472	642	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	1.73e-32	78	224	442	579	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033840	PspC_relate_1	2.88e-32	31	186	478	629	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033930	pneumo_PspA	4.54e-31	61	199	484	635	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU04040.1	9.24e-73	234	416	45	227
CBL19417.1	3.68e-72	234	416	45	227
QMW77434.1	7.15e-72	238	418	914	1094
QIB58002.1	7.15e-72	238	418	914	1094
QRT51288.1	4.28e-71	242	416	79	253

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	4.39e-18	239	415	19	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009477	0.986485	0.002575	0.000919	0.000294	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002475_00103.