CAZyme Information: MGYG000002475_00104

Basic Information

• Species: Lactonifactor longoviformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor longoviformis
• CAZyme ID: MGYG000002475_00104
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035		114550.95	4.5216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002475	4812037	Isolate	Germany	Europe

• Gene Location: Start: 30361; End: 33468 Strand: -

Full Sequence      

MKNIRKKLLCYVLTAVMLLTAWTPAYASSQAHDSLPEEEPAQETQPDNDSRDSLSLDCQL
LLTQEDDTHQSVILEMGDTSTVMEKAVLSYQDGDGEIHTAEAEEIVENYAAFLLDLPGEG
VTRTFLSIVTTVGGQDIETGLQPEEEMDTLSIDEEQAAEIIGDTENQTDTENLSEEELDY
VNQTVVTKEGEDGLTASDISEVLQSEAAPASMSRSALSAPKAGDKAGTFTVVLDPGHGGM
DGGAEYTFSDGTKFVESQLTLKIANYVKEALAAYPEIQVYMTRTGDTYLPDLEERVAIGV
EKNADIFVSLHLNSADSEKAHGVEILVPRTGRYNNDVAEDANQLASNILDNLVALGLYNR
GLKYKDSANGTKYPDGSKADYYGIIRNCMEQGLPGVIVEHAFLSGTEDKKFLDSEEDLKK
LGQADAKGIAQYFNLESSNNPNNNLNGWKQVNNKWYFYKDGQKLTGWQYIYGKWYYLNSS
GIMQTGWQFISGKWYYLESSGAMAEGWKKLGNTWYYLTPGNGAMVNGWQKIGSEWYYFNG
SGAMQTGWLLLDGKWYYLNGSGARAKGWITLGKTRYYLNPETGVMSVNWNLIDGKWYYFN
ASGASLTGWQYISGKWYYLESDGAMAEGWKKLGKTWYYLTPGNGAMKTGWYLVGNTWYYS
DSSGAMKTGWQKIGGKWYYLNSSGAMAEGWLKLGKTWYYLTPGNGAMKTGWYLVGNTWYY
SDSSGAMLTGWQKIGGKWYYMNSSGAMLTGWQKIGGKSYFFDNSGVWIEHPAQGWQLENG
NWYYIGANGYHTGWLLNGGKWYYMDSTGKMLTGWQTVGGKTYYLLSSGAMVSGCYYTVDG
ITYTFTQSGESLGNIDEYPGYKIMGTSSVTADQMVKYFAASKQAYPAEVLAKGGAPDIKT
FCQIFLEECQTEGVKAEVAFTQAMKETGWLQYGGDVKIEQFNFAGLGATGGGVPGLSFAD
VRTGIRAQVQHLKAYASRDNLVQTCVDPRFTYVTRYSSPFVEWLGIPDNPFGGGWAAGKN
YGSSLIGMITTLKSM

Enzyme Prediction     

No EC number prediction in MGYG000002475_00104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	902	1031	2.3e-17	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	7.32e-75	465	687	443	643	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.66e-70	527	727	444	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.61e-70	543	747	440	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	1.34e-61	645	841	440	639	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.76e-60	447	687	487	666	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99413.1	1.32e-142	61	1035	117	1094
ASU27509.1	1.85e-142	1	1035	1	1094
ANU74705.1	1.85e-142	1	1035	1	1094
QQQ92252.1	1.85e-142	1	1035	1	1094
QMW77434.1	3.60e-142	31	1035	90	1094

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JWQ_A	1.29e-16	231	436	4	179	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
4RN7_A	7.42e-16	229	440	4	187	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
5EMI_A	8.37e-14	227	433	3	178	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
5J72_A	1.12e-13	218	429	438	633	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
4BIN_A	2.07e-12	216	433	159	393	Crystalstructure of the E. coli N-acetylmuramoyl-L-alanine amidase AmiC [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	9.46e-20	898	1025	68	188	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1
P36548	1.59e-13	218	433	46	276	N-acetylmuramoyl-L-alanine amidase AmiA OS=Escherichia coli (strain K12) OX=83333 GN=amiA PE=1 SV=1
Q9K0V3	7.11e-13	231	434	192	409	N-acetylmuramoyl-L-alanine amidase AmiC OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=amiC PE=1 SV=1
P54525	2.68e-12	230	433	31	204	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
P33772	1.00e-11	186	433	16	276	N-acetylmuramoyl-L-alanine amidase AmiA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=amiA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002102	0.991354	0.005738	0.000315	0.000222	0.000215

TMHMM  Annotations     

start	end
7	26