CAZyme Information: MGYG000002475_00973

Basic Information

• Species: Lactonifactor longoviformis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lactonifactor; Lactonifactor longoviformis
• CAZyme ID: MGYG000002475_00973
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000002475_43|CGC1	96367.14	4.7834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002475	4812037	Isolate	Germany	Europe

• Gene Location: Start: 1719; End: 4235 Strand: -

Full Sequence      

MKKLCLNENWQLHEAPLKWGKEYKSQIDRQTDGWYDCSLPADVRMPLIEAGVIKDPVLSD
YCRESEWIEDRSWWFRKTFDGSAVCMEDDIVELVLEGLDTRSDIFINGQFIGCHRNVHYP
FVYDVKDLLVPGENEIMVRVTSGLEEVAEEDLAELDHAVCLESNNGGEFRGDGRRSFVRR
PQYTVGWDWGPKVITIGITGNVCLRSYKTIAIREVHLHTEKLGETARVHAMVNIEDLCFI
SSKSCDVTVQMVREGAVCAEAKLEKQLLTSGYNYLDLELEVKNPCLWWPNGYGEQPLYEV
RVCAACGGETEEYPAFSFGIRTIQLDTSVIAGEDRNFILVVNGKPIYCKGGNWVPNDFIY
ARVPDEKYHVLTDEAAEANFNMIRVWGGGLYERDLFYELCDQKGLLLWHDFMFACSTYPD
HQQWFRDEMRQELDYQTKRLRNHCCMGLYCGTNEVHWIFNSIDNPRWGIEFSYEHQYGLR
IANLMAKEIIRNNCPQIPYWNSSPYGGDLPNDDTVGDVHRWHNALMSKKMEERIEAKDYD
TIESKFVSEYGFIGPCCRKSTEEYMDGASMDREGNIWHMHSNVFEKGTVNAAIEKNYLDH
PETLSLDEYILYGGMVHGLMYGYSLEAIRFKEHCGGGLFWMYNDAWGEVGWTIIDYYLRR
KIPFYAVKRALAHQKFTMRAADGQLVLQGANDYPEDLEVSGKIGYVSFDGKVKELRDIVL
KVPAGERIYLLKEKLPERDYAAGTVMLYTDSDAVDNIWLRTDDMRQLNFGPNPVRTVEIR
QEGEDKLVTVTADGFAHGVYAKGDYDCSDCYFDLLPGEVKTFRIKGIGGKEPVIKQVK

Enzyme Prediction     

No EC number prediction in MGYG000002475_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	725	3e-85	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.27e-55	1	711	10	670	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.76e-07	74	350	68	296	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	1.21e-06	772	825	1	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK09525	lacZ	1.69e-06	197	405	208	408	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	1.69e-06	74	140	68	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99829.1	0.0	1	826	1	826
QMW77011.1	0.0	1	826	1	826
QIB55134.1	0.0	1	826	1	826
QBE97186.1	0.0	1	838	1	836
BBI35730.1	3.91e-252	3	824	2	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.35e-122	22	825	34	811	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	9.19e-95	31	824	22	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	9.57e-95	31	824	24	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	9.76e-95	31	824	24	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.51e-94	31	824	22	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	5.62e-84	14	835	6	837	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	1.38e-81	17	835	9	837	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	1.94e-81	14	835	6	838	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	2.68e-81	14	835	6	838	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A2QYN2	9.76e-81	17	831	9	835	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002475_00973.