CAZyme Information: MGYG000002476_02301

Basic Information

• Species: Yersinia pestis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia pestis
• CAZyme ID: MGYG000002476_02301
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43072.61	8.8258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002476	4935125	Isolate	Russia	Europe

• Gene Location: Start: 2414165; End: 2415319 Strand: -

Full Sequence      

MIYLAAIWLGILLFKLIFTLRMMKRGKQAGCGVPQATATILQPVLSGDPQLATVLEANVV
ALKQARFFWLIDDDDTVAREIAISIQSRYPDREIKASYFPPAPEGVNPKVFKLEQAWREV
ESDILLVLDDDAFLSAESFGTLLNQIEEGALVTALPYYCADSNGYSRLLAQFVNDNSGFT
YLPLLPFSPPLTINGMCYAISVNTLAQVGGFAAILHDLADDLALATLLRQHHIRLIQSTA
PVRVQTSLSSGKKYIQQMHRWFLFATLLLREKTVLIKLIIFLLQGLHPLLMWAMLLTVGW
EWVTAAHGITGINLGIIAACLLIRHAALRHVQQAIAPDIRSNPIFSLLSELMQPLHLLHA
LCNRTIYWRTRRYRVLSNKKFNSL

Enzyme Prediction     

No EC number prediction in MGYG000002476_02301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT21	39	261	2e-23	0.9656652360515021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13506	Glyco_transf_21	1.14e-44	93	265	2	173	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
cd02520	Glucosylceramide_synthase	8.39e-10	39	261	4	192	Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment.
pfam13641	Glyco_tranf_2_3	4.11e-08	39	261	5	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam13632	Glyco_trans_2_3	1.94e-05	124	303	1	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK14353	glmU	0.003	123	171	101	149	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS46246.1	1.18e-273	1	384	1	384
QPA88592.1	7.96e-272	1	384	1	384
QFR72864.1	7.96e-272	1	384	1	384
ABG13332.1	7.96e-272	1	384	1	384
QPA84494.1	7.96e-272	1	384	1	384

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q16739	3.45e-09	39	261	54	276	Ceramide glucosyltransferase OS=Homo sapiens OX=9606 GN=UGCG PE=1 SV=1
O88693	1.09e-08	39	261	54	276	Ceramide glucosyltransferase OS=Mus musculus OX=10090 GN=Ugcg PE=1 SV=1
Q5BL38	1.07e-07	39	261	54	276	Ceramide glucosyltransferase OS=Xenopus tropicalis OX=8364 GN=ugcg PE=2 SV=1
Q5U4S8	1.05e-06	39	261	54	276	Ceramide glucosyltransferase-B OS=Xenopus laevis OX=8355 GN=ugcg-b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	21
274	296
306	328