CAZyme Information: MGYG000002476_03106

Basic Information

• Species: Yersinia pestis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia pestis
• CAZyme ID: MGYG000002476_03106
• CAZy Family: GT4
• CAZyme Description: Glutamate/aspartate import solute-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000002476_3|CGC26	33649.43	8.4246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002476	4935125	Isolate	Russia	Europe

• Gene Location: Start: 3295463; End: 3296380 Strand: +

Full Sequence      

MQMRKLALVLLLAGMTSSVAQAEDATAKADTAIDTLQKVKNNGVIVVGHRESSVPFSYYD
NQQKVVGYSQDYSNLIVDAIRKELNAPNLEVKLIPITSQNRIPLLQNGTFDFECGSTTNN
LERQQQAAFSNTIFVVGTRLLTKKDSEVKDFKDLAGKAVVVTSGTTSEVLLNKLNEKDNM
NMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDEWSIVGTPQSEEAYGCM
MRKNDPAFKALLDKTIATAQTTGVAEKSFDRWFKNPIPPKNLNMNFALSDEMKALFKAPN
DKALN

Enzyme Prediction     

No EC number prediction in MGYG000002476_03106.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10797	PRK10797	0.0	1	305	1	302	glutamate and aspartate transporter subunit; Provisional
cd13688	PBP2_GltI_DEBP	1.18e-110	36	273	1	238	Substrate-binding domain of ABC aspartate-glutamate transporter; the type 2 periplasmic binding protein fold. This subfamily represents the periplasmic-binding protein component of ABC transporter specific for carboxylic amino acids, including GtlI from Escherichia coli. The aspartate-glutamate binding domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd01000	PBP2_Cys_DEBP_like	1.40e-78	36	273	1	228	Substrate-binding domain of cysteine- and aspartate/glutamate-binding proteins; the type 2 periplasmic-binding protein fold. This family comprises of the periplasmic-binding protein component of ABC transporters specific for cysteine and carboxylic amino acids, as well as their closely related proteins. The cysteine and aspartate-glutamate binding domains belong to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd13689	PBP2_BsGlnH	1.64e-64	36	274	1	229	Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
pfam00497	SBP_bac_3	1.25e-55	45	273	1	223	Bacterial extracellular solute-binding proteins, family 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXX81055.1	3.66e-169	1	305	1	297
QQO61625.1	7.37e-169	1	305	1	297
QET99138.1	1.05e-168	1	305	1	297
BBV07546.1	1.05e-168	1	305	1	297
QIB31157.1	1.05e-168	1	305	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VHA_A	2.08e-167	29	305	3	279	DEBP[Shigella flexneri],2VHA_B DEBP [Shigella flexneri]
2IA4_A	1.48e-160	29	305	3	279	Crystalstructure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301],2IA4_B Crystal structure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301]
5EYF_A	5.45e-26	34	275	6	238	CrystalStructure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO],5EYF_B Crystal Structure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO]
1XT8_A	3.74e-15	10	274	12	265	ChainA, putative amino-acid transporter periplasmic solute-binding protein [Campylobacter jejuni],1XT8_B Chain B, putative amino-acid transporter periplasmic solute-binding protein [Campylobacter jejuni]
3K4U_A	3.09e-13	43	273	5	227	CRYSTALSTRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes],3K4U_B CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes],3K4U_C CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes],3K4U_D CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes],3K4U_E CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes],3K4U_F CRYSTAL STRUCTURE OF putative binding component of ABC transporter from Wolinella succinogenes DSM 1740 complexed with lysine [Wolinella succinogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZF60	1.59e-172	1	305	1	302	Glutamate/aspartate import solute-binding protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=gltI PE=3 SV=3
P37902	3.56e-169	1	305	1	302	Glutamate/aspartate import solute-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=gltI PE=1 SV=2
Q9I402	5.22e-112	16	303	10	298	L-glutamate/L-aspartate-binding protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1342 PE=1 SV=1
O34563	1.95e-22	9	274	15	268	ABC transporter glutamine-binding protein GlnH OS=Bacillus subtilis (strain 168) OX=224308 GN=glnH PE=2 SV=1
P27676	2.20e-22	17	255	31	262	Glutamine-binding protein OS=Geobacillus stearothermophilus OX=1422 GN=glnH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.998978	0.000230	0.000186	0.000166	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002476_03106.