CAZyme Information: MGYG000002476_03551

Basic Information

• Species: Yersinia pestis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia pestis
• CAZyme ID: MGYG000002476_03551
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000002476_3|CGC34	37759.81	10.0966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002476	4935125	Isolate	Russia	Europe

• Gene Location: Start: 3807656; End: 3808726 Strand: -

Full Sequence      

MSGKTKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEASLVPQHGIEIDFI
KISGLRGKGLMAQLTAPIRIYRAVRQAQKIMRDYQPDVVLGMGGYVSGPGGLAAWLCGVP
VVLHEQNGIAGLTNRWLARIAKKVLQAFPGAFPNADVVGNPVRTDVLALPLPAVRLSGRE
GPIRVLVIGGSQGARILNQTLPLVAASLGEQITLWHQVGKGALPEVSQAYQQAGQAGHQV
VEFIDDMAAAYAWADVVVCRSGALTVSEVAAAGLPAIFVPFQHKDRQQYWNALPLEKAGA
AKIIEQPQFTATSVSSLLAGWDRATLLSMAERARSVAIPDATERVAAEVVAASKSA

Enzyme Prediction     

No EC number prediction in MGYG000002476_03551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	185	341	9e-48	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	0.0	6	355	2	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	1.92e-154	6	355	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	4.67e-149	7	348	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	5.83e-148	6	349	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam03033	Glyco_transf_28	1.70e-53	8	146	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYW90475.1	5.23e-256	1	356	1	356
AYW89359.1	5.23e-256	1	356	1	356
AZA31673.1	5.23e-256	1	356	1	356
AYX15657.1	5.23e-256	1	356	1	356
AYW94912.1	5.23e-256	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.60e-209	1	349	2	350	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.86e-91	8	345	5	347	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	1.20e-87	4	345	8	358	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1JK81	1.05e-256	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=murG PE=3 SV=1
B2K4E6	1.05e-256	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=murG PE=3 SV=1
Q66EK5	1.05e-256	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=murG PE=3 SV=1
A7FM66	1.05e-256	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=murG PE=3 SV=1
Q1CMM7	5.80e-254	1	356	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002476_03551.