CAZyme Information: MGYG000002478_00145

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00145
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MGYG000002478_1|CGC7	87966.09	6.5822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 219657; End: 222023 Strand: +

Full Sequence      

MNKHTLFTVASFLFCTQVSGDTPDGIYHKGWIDFNKNGKMDLYENPKAPLEERVQDLLSQ
MTLEEKSCQMATLYGSGRVLKDALPQDNWKTEVWKDGIGNIDEEHNGLGTFKSEYSFPYT
KHVDAKHAIQRWFVEETRLGIPVDFTNEGIRGLCHDRATYFPAQCGQGATWNKELIARIG
EVEAKEAVALGYTNIYSPILDIAQDPRWGRCVETYGEDPYLVGELGKQMITSLQKHNLVA
TPKHFAVYSIPVGGRDGKTRTDPHVAPREMRTLYIEPFRMAFQEAGALGVMSSYNDYDGE
PITGSYHFLTEILRQEWGFKGYVVSDSEAVEFISSKHKVANTYEDGIAQAVNAGLNIRTH
FTPPADFILPLRKAVADGKISQETLDKRVAEILRVKFWLGLFDNPYRGNGKQAEQIVHSK
EHQAVSLEAARQSLVLLKNEMNLLPLSKSLRSIAVIGPNADERTQLICRYGPANAPIKTV
YQGIKERLPHTEVIYKKGCDIIDPHFPESEVLDFPKTTEEARLMEEAIHAAKQAEVVVMV
LGGNELTVREDRSRTSLNLPGRQEELLKAVCATGKPVVLVLLDGRASSINYAAAHVPAIL
HAWFPGEFCGQAVAEALFGDYNPGGRLAVTFPKSVGQIPFAFPFKPGSDESSSTSVYGVL
YPFGHGLSYTTFSYGDLKISPLRQGVQGDINISCKIKNTGKIKGDEVVQLYLRDEVSSVT
TYTKVLRGFERISLEAGEEQMVHFRLRPQDLGLWDKNMNFRVEPGKFKVMIGSSSTDIRL
HGRFEIAP

Enzyme Prediction     

No EC number prediction in MGYG000002478_00145.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	135	357	1.2e-64	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	786	1	764	beta-glucosidase BglX.
PLN03080	PLN03080	1.24e-98	138	770	78	759	Probable beta-xylosidase; Provisional
COG1472	BglX	2.04e-79	129	488	48	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.68e-70	434	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.74e-58	62	395	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA72174.1	0.0	1	788	1	788
AII66331.1	0.0	1	788	1	788
QJR61033.1	0.0	1	788	1	788
QJR54169.1	0.0	1	788	1	788
AND18153.1	0.0	1	788	1	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	3.35e-133	47	779	5	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.84e-132	47	779	5	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	8.20e-132	43	786	7	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5Z87_A	5.46e-131	37	779	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
7EAP_A	6.31e-131	43	786	7	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	1.38e-133	41	786	22	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	3.73e-129	54	786	38	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	4.63e-129	138	775	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.99e-115	43	779	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	8.40e-99	50	778	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999184	0.000138	0.000157	0.000146	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00145.