CAZyme Information: MGYG000002478_00205

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00205
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1095	MGYG000002478_1|CGC9	123336.12	7.5524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 327453; End: 330740 Strand: +

Full Sequence      

MQKILLFIASLFYFNFLFSKNEIKSWQGIHETPLSRLEQQFAEPPVEFANHVIWGWEGKM
DKKTICNDLDSIKKKGFRAVIFEAGYKLPFKYLSEEWFKAIRTGVVEAKKRDMKVWIIDE
GKYPSGFAGGKFSQERPDLRMQALVIGDTIQIKRGEVMTNHKIAPEIISAVAVSTSGAPN
RTVEINNGKISFNAGLDDWKILLVKSDFRTAVTRAVNNPNGGKDATNSLCDYLNPVAVQQ
FIDWTHKQYKKYLGKELGTTVLGFRGDEPDYAHLPWTPSIVQTFKDTKGYDPTPYLASFF
TASPTIQEQRVKADYWDVWSSLFATHFFKLQADWCAANGVAHITHLNKEHEMPACVKAEG
DYFRALSKVQIPGVDAIWNQIWPSTLNDFPKLASSVAHVYGKPRAFSESFAAYHISPTIP
QAKFVVDHQIARGINFFEFMFWLAGSKHRNWMSDPGMKGLNEYTNRTTYLMSQGKPGARI
AMYYPTSTMWLGNNEVYKDIVTLTQQLLTHQRDFDYINDDAFTEALTIGPGYLENKSSQR
YETLIIPSSDVISVSAWKVIETFSSRGGKVLFWGKKPTSFIDKNFTAPGSLSDLTNSRIE
PSTRWTAHVSSSLPEPEMKIISPDNDSIRYTRRVMPDGDLYFIFNEGNKATEFTADFDKV
GVVKEWNATDGTLQPINATIVNNRTRLTIKLEAWESKLISIGKNNREYNIKEYGVKGNGY
SETATLQRIINEAAHNGGGTIVIPAGEYLSGALFFPRGVDLRIEKNAKLISTVDPNEFPV
IPTRFEGIEKRWRCAFLNFDHSDGVKVYGEGVIDGKGVEWKKIPFGNSGRPRLVCFTDCP
GGKISGLKMINQASWCLHVLYTNGFTIDGIDIRALEYIPSSDGIDIDSSNDILITSTRIE
AHDDCISIKSGRDEDGRRVGRPSENILIENCHFAYGHGGVAMGSEISGDIRNVTIRSCLM
DNENWSPLRFKSQPSRGGTVENITFEDIIIKGARSIFDINMEWRMVPPLLPAHYPLTCLR
NIHFKNINGEAQSAGTMYGFKEAPFGNDTFFFENCHIKAQKGLSISNVANVNFKGLELEI
KEGEKIYERSANKDK

Enzyme Prediction     

No EC number prediction in MGYG000002478_00205.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	37	707	3.2e-82	0.7912621359223301
GH28	734	1068	3.4e-71	0.9476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.47e-58	706	1000	81	405	Polygalacturonase [Carbohydrate transport and metabolism].
pfam17132	Glyco_hydro_106	3.09e-37	188	680	364	873	alpha-L-rhamnosidase.
pfam00295	Glyco_hydro_28	4.14e-29	740	1036	8	282	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	2.18e-20	702	1034	31	351	polygalacturonase/glycoside hydrolase family protein
PLN02793	PLN02793	4.44e-17	703	991	48	328	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR61086.1	0.0	1	1095	1	1095
AII66387.1	0.0	1	1095	1	1095
QJR54116.1	0.0	1	1095	1	1095
ALA72222.1	0.0	1	1095	1	1095
QJR77999.1	0.0	1	1095	1	1095

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.54e-42	705	1003	25	362	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	2.75e-40	705	1071	42	441	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	1.64e-11	709	1033	158	538	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
4C2L_A	1.44e-10	738	1000	45	301	Crystalstructure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	3.27e-10	790	992	56	253	Structuralinsights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	8.05e-27	691	997	48	365	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
O22818	2.93e-19	709	1033	34	346	Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana OX=3702 GN=At2g43860 PE=2 SV=1
Q6H9K0	1.71e-17	708	1029	10	318	Exopolygalacturonase (Fragment) OS=Platanus acerifolia OX=140101 GN=plaa2 PE=1 SV=1
P27644	7.78e-17	832	1003	23	196	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9SFB7	9.53e-16	706	1029	69	382	Polygalacturonase QRT2 OS=Arabidopsis thaliana OX=3702 GN=QRT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.737553	0.253378	0.008543	0.000194	0.000129	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00205.