CAZyme Information: MGYG000002478_00517

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_00517
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000002478_1|CGC15	88349.91	5.6118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 735296; End: 737644 Strand: -

Full Sequence      

MKKLLTLLLAVLLLAGCAGNKSGTFEAGKNTFLLNGKPFVVKAAEVHYPRIPREYWEHRI
EMCKALGMNTLCLYVFWNLHEETPGNYDFTGNKDIAAFCKLAQKHGMYVIVRPGPYVCAE
WEMGGLPWWLLKNDSVQLRTLDPFYMQHVGAFMHEVGKQLQDLQITRGGNIIMVQVENEY
GSYGTDKPYVSAIRDTVRAAGFTEVPLFQCDWSSNFLNNGLDDLLWTVNFGTGADIDKQF
AKLKEVRPDAPLMCSEFWSGWFDHWGRKHETRDGQIMVDGLKEMMDKGISFSLYMTHGGT
TFGWWGGANNPAYSAMCSSYDYDAPISEAGWTTDKYFALRNMLKDYMDEGQTLPEVPEAL
PVMEVPAIKFTQVAPLINNLPEPKQTEEIRPMEKFDQGWGSILYRTRLPEDVKAGTILKI
TEQHDWTQIFADGKLLGRLDRRGGEQELTLPALKAGTQLDLLVEAMGRVNFDKSIHDRKG
ITEKVELVNGKNAETLKGWTVYNLPVDYEFVSSRNFQDMNSSAACGIEKNDESVPAYYRA
TFTLDKVADTFLNMESWGKGMVWVNGRAMGRFWEIGPQQTLFMPGCWLKKGVNEIIVLDL
KGPKEATIVGLDKPILDMLRVAVPETHRKQGQTIKLEKETPVAAGTFKPGNGWQEVKVPA
TKGRYFCLEGLASFDNTNIAAIAEFDVLDEKGQKISRENWKIVYADSEETRSGNRTADKI
YDLQESTFWQTVDNTAYPHQVVIDLGKEYNVTGFRILPRAEQGAPGMIKDYKVYVKTTGF
GY

Enzyme Prediction     

No EC number prediction in MGYG000002478_00517.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	32	344	1.3e-118	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.72e-152	31	344	1	316	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.89e-40	17	344	24	340	beta-galactosidase; Provisional
COG1874	GanA	1.73e-38	31	603	7	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	3.77e-09	705	779	2	74	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02449	Glyco_hydro_42	7.94e-09	48	181	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR53842.1	0.0	1	782	1	782
AII65626.1	0.0	1	782	1	782
ALA72479.1	0.0	1	782	1	782
QJR61358.1	0.0	1	782	1	782
QJR69775.1	0.0	1	782	1	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	2	780	3	777	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	5.12e-304	23	632	6	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	3.66e-146	30	626	22	599	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	2.76e-122	26	616	36	645	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	2.78e-122	26	616	12	621	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	5.04e-124	5	583	9	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q60HF6	1.03e-123	3	616	7	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P16278	1.76e-123	3	616	7	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	1.91e-122	3	616	7	644	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q9TRY9	2.09e-122	18	616	28	645	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_00517.