CAZyme Information: MGYG000002478_01383

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_01383
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000002478_1|CGC35	34942.01	7.278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 1841567; End: 1842481 Strand: +

Full Sequence      

MAIVIPAYKGRFLKETLDSIAVQAHKDEFVLYIGDDASPERLDKIVESYWNKVNLVYHRF
SENMGGKDLVAHWERCIQLSAEPFIWLFSDDDLMPADGVERVMEALSRPHHQRGYFFRFP
LAVIDGENKRIRANRPLEEGSVSCYRLLLDKLQGKIDSAAVEYVFSREIWQSAGGFVHFP
MAWCSDDATWAAFARHAGGVISLPGQPVCWRNVEGANISNSAGHDKDKLHATILFLRWMR
NMFSDYVDDPELINALQCYIHTILRISLHKHYNICGLWGVSMALGRFNKRAAFTTFFRNF
RLFS

Enzyme Prediction     

No EC number prediction in MGYG000002478_01383.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	4.31e-10	2	217	1	213	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04185	GT_2_like_b	6.07e-05	13	112	12	110	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04195	GT2_AmsE_like	0.006	12	76	14	79	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALA73196.1	4.63e-232	1	304	7	310
QJR57296.1	4.44e-230	1	304	7	310
QJR57910.1	4.44e-230	1	304	7	310
AND19075.1	4.44e-230	1	304	7	310
QJR70786.1	4.44e-230	1	304	7	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_01383.