CAZyme Information: MGYG000002478_01901

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_01901
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1011	MGYG000002478_1|CGC44	114682.89	7.0504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 2473610; End: 2476645 Strand: +

Full Sequence      

MKSAIKKIFVLTGCVLLLVTSMRAQRACLNLSETLWNITLDRSAVWQNDSLYVPPVNIHD
LPVHIPTGGWNLLDTPDKIGVTLPATVEQHLWGWNGETFGVTGNYVGVSWFDTKINVPAD
WRNKRIVMNVASVRFRAEIFVNKKLVGYDLVNSTPFAVDVTPFILPGQENVIAFRITDPN
GNFNWKDSQVYTWGEYRTNPSHGFGGITGKVELVATDKLYIGDVFIKNQPDPHSIEVEVT
ACNETKNPMKAQKMLLTVKEHKGEKVLYRKEYSVENLVVGENKQTFHIHLPAAKLWSTDS
PHLYDLSVSVGTDNYTQRFGFRWFEVKDIHGDKQFFLNGKRIVLRTAISWSFWPDNGITP
SDELARRQVESAKKLGLNMLNFHRTIGHSNVLDYADELGLLYFEEPGGNQYPISHFNDNN
KQSKFYFAYRNEKLVRMIKRDRNHPSLVIYNLHNERGAWPQVQDYAQMRMAHSLDPTRIL
TYNSSNGENPENEANARFKLHLMPNDTTFYDYGWYDRHHAGGPGCYHDNLYWGKDNYHRF
SDHKDEIIYWGEDGAIGTPPRLQLIRDEILQSGTTSGWEAMDYMKWYDAYDSFLKHNGFA
KAFPTVDDLTRAMGNVAFYYQGRVIENIRISNTVDAYAVNGWESMKLENHSGIVDNYRYP
KGDVEVMARYNQPLFLAVKMNRKVLNVGDTTIVDTYIVNEKNLKGNYSLQLIAKDAEGTV
LATHVSSVHVKGGNVYGQCLQIGWNFVPRATGYVCIEAKLVKGKKTFATGDDSLFAVSLN
TKGITANGSIADTTGVLSNFMKTVGFDIPEYKEGTPSGDYLLVGAFEPTQWGSGMSDIME
WVYKGHTLIIVDNAERWAEFLADKEVLDYRGSKKLGTAWYGGNFFNREHPIFDGLPVNCV
FNWEYQCFATYNRHRVGLRCFNGETLVACVSDHKKEVYSALSVIPAGRGKIIITTLDIPA
CIKDVKAYTVPVDLDGMNESMNTFNTKSENRANVVGQQLLLNLIKESNRSL

Enzyme Prediction     

No EC number prediction in MGYG000002478_01901.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	78	700	2.1e-77	0.6675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.41e-39	57	598	26	548	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.75e-25	104	482	62	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.72e-20	117	482	119	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	3.12e-12	220	322	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	9.96e-11	324	491	1	168	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR62726.1	0.0	1	1011	1	1011
QJR75369.1	0.0	1	1011	1	1011
ALA73626.1	0.0	1	1011	1	1011
QJR56769.1	0.0	1	1011	1	1011
AII67877.1	0.0	1	1011	1	1011

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	5.75e-24	115	482	117	465	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	5.75e-24	115	482	118	466	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ED1_A	9.68e-23	70	515	48	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6U7J_A	4.31e-21	104	455	72	417	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6ED2_A	1.05e-19	69	515	60	501	ChainA, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	3.15e-23	115	482	118	466	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	7.40e-22	104	478	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	8.53e-22	57	478	66	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	3.33e-17	115	478	62	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
Q9K9C6	3.95e-16	61	482	82	485	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000783	0.987816	0.010756	0.000226	0.000186	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_01901.