CAZyme Information: MGYG000002478_01958

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_01958
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	MGYG000002478_1|CGC46	47107.63	6.4079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 2569738; End: 2570976 Strand: -

Full Sequence      

MKNYCYIYLLAACMAPMSLQAKKAIPYSGEVCIAPLPTVPTPLPGISSDSYAQRFADSEM
LRFPKAYQLDHGKRLFFGYSQGVGCCAMLDMWKNTGDKRYFTYVEEWADSLINEKGEIHL
YDMSTYNLDYINSGKVLFDLYKETGKEKYKAAMDLLVEQLKRQPRTLEGGFWHKLIYQHQ
MWLDGLYMASPFLARYGAEFNRPDLIDEAVKQFTLCHKHTYSPETGLYHHAWDESKSQRW
ANPQDGTSPNFWGRSIGWWFMAMVDVLDYIPDNHPGRASLISWIQGLAESLPNYQRDGLW
YQVIDQPEREGNFPEASVTTQCMYAYAKAVNKGYIDAQYRTIAEKAFNGLKQTLLLENPD
GTLTLTRCCQVGGLGGTPYRDGSFEYYIGEKMRDNDAKATGPFIMGCLQLGK

Enzyme Prediction     

No EC number prediction in MGYG000002478_01958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	77	410	1.3e-117	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.18e-112	51	405	1	334	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.68e-103	78	405	35	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65043.1	0.0	1	412	1	412
QJR71380.1	0.0	1	412	1	412
AII67934.1	0.0	1	412	1	412
QJR67042.1	0.0	1	412	1	412
QJR56716.1	0.0	1	412	1	412

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.76e-98	77	405	23	353	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.20e-84	79	410	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.97e-84	79	410	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.31e-22	68	350	71	361	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	1.21e-17	79	350	49	320	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.55e-84	79	410	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.37e-38	188	405	1	223	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.37e-38	188	405	1	223	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	3.26e-12	182	354	201	369	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001639	0.761565	0.235711	0.000480	0.000310	0.000260

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_01958.