CAZyme Information: MGYG000002478_03018

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_03018
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000002478_1|CGC58	45350.8	7.582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 3715686; End: 3716882 Strand: +

Full Sequence      

MKRTGLNIICSLLLVGGMCACIATPKQTEEIKWSERMAQSEMQRFPEPWMIEKAKKPRWG
YTHGLVVKSMLEEWKHTGDTAYYNYAKIYADSLIDTDGKIKTMKYLSFNIDNINAGKILF
DFYEKTGDGRYKVAMDTLRKQLTEQPRTSEGGFWHKLIYPHQMWLDGIFMASPYLAQYGN
VFKDTTVNADIVNQIKLIARKTYDPKTGLFYHGWDESKTQNWANKETGCSPNFWSRSIGW
YAAAVVDVLDYMPAQFEGRDSIMTIINMLAEGIVKYQDPETGVWWQVTDQNNRKGNYLES
SASSLFVYFLCKAVNKGYISSEYKMAAERGFNGLIKQFIKEEPDGSYTITNCCAVAGLGG
KGNRDGSFAYYIGEPVIENDPKSVGSFILAAIEYEKMK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	396	1.7e-122	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.83e-133	33	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.18e-108	56	396	31	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR59237.1	1.46e-306	1	398	1	398
ALA74594.1	1.46e-306	1	398	1	398
QJR55965.1	1.46e-306	1	398	1	398
AII68766.1	1.46e-306	1	398	1	398
AND20254.1	8.42e-306	1	398	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.65e-109	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.06e-93	58	397	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.37e-93	58	397	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.81e-23	59	351	65	342	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	5.97e-20	142	341	178	368	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.78e-93	58	397	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.50e-34	170	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.50e-34	170	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	2.76e-06	164	336	201	367	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.147279	0.851930	0.000140	0.000139	0.000107

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_03018.