CAZyme Information: MGYG000002478_03019

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_03019
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	MGYG000002478_1|CGC58	56438.55	6.7267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 3717079; End: 3718548 Strand: +

Full Sequence      

MNRHALLSLLALLLCYSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETG
WLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMIDGFNFKDINRKGI
YGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIW
MIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGH
RRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRW
NQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQM
KYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKIS
GAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKTWTAL
PDAIQKWNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	34	463	1.9e-172	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.94e-157	42	370	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	3.04e-40	376	465	1	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR57645.1	0.0	1	489	1	489
ALA76191.1	0.0	1	489	1	489
AII68767.1	0.0	1	489	1	489
QJR61953.1	0.0	1	489	1	489
QJR66221.1	0.0	1	489	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QFU_A	0.0	23	489	18	484	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
5MSY_A	2.89e-290	26	475	8	454	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	3.77e-279	26	475	8	454	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000470	0.998707	0.000302	0.000185	0.000161	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_03019.