CAZyme Information: MGYG000002478_03035

Basic Information

• Species: Phocaeicola dorei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola dorei
• CAZyme ID: MGYG000002478_03035
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1063	MGYG000002478_1|CGC59	122092.24	6.6494

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002478	5444912	Isolate	Finland	Europe

• Gene Location: Start: 3738671; End: 3741862 Strand: +

Full Sequence      

MRIYGLLLCGWMTVSLQAQQIHDWENHHVLQINREPARAAFVPFAKQKGDCSMSLDGMWK
FRWTPVPSERIADFYRTDFNDEDWKSFPVPANWEINGYGTPIYVSAGYPFKIDPPRVMGE
PKASYTTYKERNPVGQYRRTFILPAGWKADGQTFLRFEGVMSAFYVWINGERIGYSQGSM
EPSEFNITRWLKPGENQIALEVYRYSDGSYLEDQDFWRFGGIHRSIHLVHTPDIRIRDYV
VRTLPAVQGNYQDFRLLIDPQFSVYQGMDGKGYTLQAVLKDADGREIVNMVGNVEDILDL
EHKAARMNEWYPQRGPRKMGRMSAVIKSPQRWTAETPYLYKLELRLQNVNGQTIEQVEQP
VGFRCIEIKDGQMLVNGNSVRFRGVNRHEHDPYTARVMSEERMLQDILLMKQANVNAVRT
SHYPNVSRWYELCDSLGLYVMDEADIEEHGLRGTLASTPDWYAAFLDRAVRMAERDKNHP
SVVMWSMGNESGYGPNFAAISAWLHDFDPTRPVHYEGAQGVNGEPDPKTVDVISRFYTRV
KQEYLNPGIPEGEDKERAENARWERLLEIAERTNDNRPVMTSEYAHCMGNALGNFKEYWD
EIYSNSRMLGGFIWDWVDQGIYKILPDGRQMVAYGGDFGDQPNLKAFCFNGVVMSDRETT
PKYWEVKKVYAPVKLEMEKDLQVFPKEQDLLVKEQDVLPKGLRVTNRNHHIGLEGYRCLW
TLIENGKKMEQGELALPLVAPGETGTMALPDVKINKQADVRLNVSIVLKEDALWAKAGHE
ILKEQFALNDHLMAVANGVQPGKRKNKFSVLDLWKDSYFQAFRAPTDNDKSFGNWLAKDW
KNQRLDAPQVEVITPETETQETNGTVSRKSVVKYRYAKGSIRVSSHYKIYVDGTVDLEQT
YLPQGELPELPRLGSAFVLGEEYENLSWYGRGPWENYPDRKTSCLIGRWSSKVSSQYTHY
PRPQDSGNHEDVTEVTLTNKEGKGIRVTAIDRPFSFSALYYTVDDIYKATHDCDLKPRKE
IILSLDAAVLGLGNSSCGPGVLKKYAIDKQKPHTLRVRFSLIK

Enzyme Prediction     

No EC number prediction in MGYG000002478_03035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	48	946	2.4e-214	0.9654255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	22	1045	15	1011	beta-galactosidase.
PRK10340	ebgA	0.0	24	1060	4	989	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.71e-157	54	948	14	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.21e-103	366	674	1	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	8.00e-86	819	1059	33	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR55764.1	0.0	1	1063	1	1063
QJR76300.1	0.0	1	1063	1	1063
AII62836.1	0.0	1	1063	1	1063
QJR72235.1	0.0	1	1063	1	1063
ALA74605.1	0.0	1	1063	1	1063

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	9.29e-203	22	1060	2	982	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	9.55e-203	22	1060	3	983	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6CVM_A	3.01e-175	12	1053	6	1014	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
1JZ7_A	6.27e-175	20	1053	12	1015	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	6.27e-175	20	1053	12	1015	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	5.23e-202	22	1060	3	983	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.84e-194	23	1033	19	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q7MG04	1.31e-189	12	1060	1	1027	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q8D4H3	1.23e-186	12	1060	1	1028	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2
B4S2K9	1.58e-186	12	1050	1	1029	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000632	0.998438	0.000327	0.000202	0.000183	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002478_03035.