CAZyme Information: MGYG000002479_00155

Basic Information

• Species: Campylobacter_B hominis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B hominis
• CAZyme ID: MGYG000002479_00155
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
145		16467.2	9.9925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002479	1714951	Isolate	not provided	not provided

• Gene Location: Start: 143944; End: 144381 Strand: -

Full Sequence      

MKKLFLFLLVVNLGICSEFNHLFIKHGKLNNISPLLLYGIAKTESSLNPNQVARNDNGSY
DIGIMQINSIHLPELKSMGYKEKDLFNPDINIGFGAIVLKRCINKWGLNYKALNCYNGKV
NNNTYNIKVVSNIANYNKNFNQIIK

Enzyme Prediction     

No EC number prediction in MGYG000002479_00155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	31	136	3.9e-18	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	4.02e-38	31	135	2	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	6.71e-25	17	130	16	130	type III secretion system invasion protein IagB.
pfam01464	SLT	1.66e-15	23	118	1	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	6.66e-12	34	118	1	80	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.01e-12	22	118	9	106	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS52262.1	2.67e-101	1	145	1	145
AGJ76555.1	2.20e-100	1	145	1	145
QEZ90321.1	2.82e-41	3	137	2	136
CBH51819.1	7.31e-38	2	138	14	159
QKF69252.1	7.31e-38	2	138	14	159

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	3.11e-09	27	99	8	82	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	1.58e-16	5	117	4	117	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	2.22e-16	5	117	4	117	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.22e-16	5	117	4	117	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
Q07568	6.63e-13	25	117	23	116	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	2.57e-12	25	117	23	116	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003583	0.988353	0.007248	0.000256	0.000265	0.000272

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002479_00155.