CAZyme Information: MGYG000002479_01229

Basic Information

• Species: Campylobacter_B hominis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B hominis
• CAZyme ID: MGYG000002479_01229
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000002479_2|CGC4	38954.67	9.8095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002479	1714951	Isolate	not provided	not provided

• Gene Location: Start: 1248659; End: 1249693 Strand: -

Full Sequence      

MKRILVSCLENSANLHFEQIYNSLGIKNYEFVGIFDKKFGSPLYDSKEFSAMGFVEILPL
IFKAKKAMNEMLKLARNCDKILLIDSPAFNLPFAKKLKENKINAEITYYILPQVWAWKQG
RVAKVEAYCDNLASILPFDSQFYSRAAYVGHPLLDEIKFQKKDYAKNGILAFLPGSRKAE
ILRLMPVFRELAKNFKNERKILVVPQNLMSNLSEIYGDTSGFKISNDTPQTLFKSDFAFI
CSGTATLEAALIGTPFVLAYKAKSIDIFIAKMFVKIAHAGLANIMFDFMGKEPLNVELLQ
NDANAKNLMLAYQNADFSRFEKGAKILREYLKYGSAKNVAKILS

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	316	8.7e-90	0.9350282485875706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	0.0	1	344	1	345	lipid-A-disaccharide synthase.
COG0763	LpxB	1.28e-95	1	343	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.44e-79	4	322	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.56e-78	4	343	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	9.26e-67	30	342	32	370	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS51562.1	4.08e-247	1	344	1	344
QKF70616.1	1.16e-159	1	343	1	348
QCU00468.1	1.66e-158	3	343	2	339
QQF52848.1	6.72e-158	3	340	2	336
QMS67137.1	1.92e-157	3	340	2	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.48e-22	84	311	97	340	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.48e-22	84	311	97	340	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FK76	1.85e-127	1	344	1	362	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) OX=407148 GN=lpxB PE=3 SV=1
Q5HWH9	1.85e-127	1	344	1	362	Lipid-A-disaccharide synthase OS=Campylobacter jejuni (strain RM1221) OX=195099 GN=lpxB PE=3 SV=1
Q9PIK8	1.22e-125	1	344	1	362	Lipid-A-disaccharide synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=lpxB PE=3 SV=1
B5Z7M7	1.62e-99	1	340	1	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
Q17WJ2	3.25e-99	1	340	1	350	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002479_01229.