CAZyme Information: MGYG000002481_01417

Basic Information

• Species: Stenotrophomonas maltophilia_F
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_F
• CAZyme ID: MGYG000002481_01417
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	MGYG000002481_58|CGC1	28309.47	10.2784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002481	4867831	Isolate	United States	North America

• Gene Location: Start: 74030; End: 74779 Strand: -

Full Sequence      

MGAAGEQHKVVAEVAAPRRRRWRWKRLLWLPVLLAAFSCLQVLVLRFIDPPVSTVMLWRY
GEALGEADWSYRLHYQWRDLDQMAPSLPISLVAAEDQRFPDHNGFDLQAIEKARDHNARG
GRLRGASTISQQVAKNLFLWQGRSWIRKGLEVWYTVLIEALWPKERILEMYANIAEFGDG
VYGAQAAAQKYWGKDAARLSPAESARLAAVLPAPRRYNAAAPGPYVQRRAAWIQRQARQL
GGASYLSED

Enzyme Prediction     

No EC number prediction in MGYG000002481_01417.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	74	235	7e-53	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.76e-130	32	249	17	235	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.17e-87	32	242	12	223	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.56e-71	32	242	34	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.46e-64	61	233	2	172	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.55e-34	80	236	72	223	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG90978.1	1.24e-182	1	249	1	249
QGL85630.1	1.24e-182	1	249	1	249
AWB79493.1	1.24e-182	1	249	1	249
QCB34934.1	1.24e-182	1	249	1	249
QNG86087.1	1.24e-182	1	249	1	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	8.56e-25	80	218	25	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	8.56e-25	80	218	25	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.78e-22	90	241	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	5.74e-19	90	218	55	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3UDF_A	3.32e-18	82	248	46	210	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8PI51	2.06e-124	15	246	11	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=mtgA PE=3 SV=1
Q4UXB0	3.40e-123	1	246	1	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=mtgA PE=3 SV=1
B0RQA5	3.40e-123	1	246	1	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=mtgA PE=3 SV=1
Q8P6V1	3.40e-123	1	246	1	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=mtgA PE=3 SV=1
Q3BQP8	1.04e-122	15	246	11	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49