CAZyme Information: MGYG000002483_00356

Basic Information

• Species: Clostridium_Q saccharolyticum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q; Clostridium_Q saccharolyticum_A
• CAZyme ID: MGYG000002483_00356
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237	MGYG000002483_7|CGC1	27743.94	7.0302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002483	3781880	Isolate	not provided	not provided

• Gene Location: Start: 66780; End: 67493 Strand: -

Full Sequence      

MIPKIIHYCWFGGNELPEESKRYIESWKRYCPDYQIIKWSEENFDVNSVPYTKEAYEEKK
WAFITDYVRLKVLYESGGIYMDTDVEVIKPLDDLLTEPGFSGFELPDKVPTGIMACEKEN
KFIGELLSLYKDKHFVDGEHHTDMTTNVELISNFSQKKGLLLNNKKQRIMDYTFYPTDYF
CPKNNRTLELTVTKNTYTIHHFAGSWLPSSGKINSKIKKVLGPKMMKKVIAVKDFLE

Enzyme Prediction     

No EC number prediction in MGYG000002483_00356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	96	9.9e-25	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.95e-23	1	122	81	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	5.65e-21	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.42e-10	1	132	45	190	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	32	84	146	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR65866.1	1.93e-104	1	225	1	225
AXE20522.1	8.72e-84	1	236	1	237
AST58537.1	1.64e-82	2	221	5	224
QBE94672.1	5.22e-82	1	237	1	238
AIQ37491.1	2.49e-81	1	221	1	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	8.38e-11	2	123	57	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
O14084	5.09e-09	2	180	64	253	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
P33300	8.87e-08	1	135	54	189	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
P38287	7.02e-07	1	131	61	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	1.20e-06	1	98	81	181	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002483_00356.