CAZyme Information: MGYG000002483_03063

Basic Information

• Species: Clostridium_Q saccharolyticum_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Clostridium_Q; Clostridium_Q saccharolyticum_A
• CAZyme ID: MGYG000002483_03063
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000002483_35|CGC1	32607.6	8.8818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002483	3781880	Isolate	not provided	not provided

• Gene Location: Start: 69228; End: 70067 Strand: -

Full Sequence      

MEEKKEQLGFHTFAICAYKDSPYLEECMASVKRQSCSSEVICCTSTPSPYISRLAEKYGI
PLYVREGKSGIREDWLFAYEKAGGKFVTIAHQDDRYRKNYTETLLAMYRKYPDMTVFCSD
YAAVMMEPKPDGSLRARLQTVNRVWLVKKFLRLPLRLRFLADRTGVKRAALLFGNSICCP
SCAYNKEELGNRLFESSFEFALDWDNLYELAGRKGRFVCSERPLIYYRVHPGATTKQCIE
DNRRKEDETAMFRKMWPEPAVRLLMHFYRKAYDAYGKQD

Enzyme Prediction     

No EC number prediction in MGYG000002483_03063.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	2.56e-08	15	113	3	107	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	2.55e-05	18	235	7	201	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04184	GT2_RfbC_Mx_like	2.06e-04	22	94	15	94	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV18695.1	2.49e-114	11	275	4	259
ADL03130.1	2.49e-114	11	275	4	259
SEU06483.1	4.09e-113	11	275	4	259
QIX92526.1	6.91e-100	11	275	5	260
QRP41490.1	2.80e-99	11	275	5	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002483_03063.