CAZyme Information: MGYG000002484_01515

Basic Information

• Species: Cronobacter malonaticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter malonaticus
• CAZyme ID: MGYG000002484_01515
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000002484_52|CGC1	43029	6.4176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002484	4470595	Isolate	Czech Republic	Europe

• Gene Location: Start: 7717; End: 8889 Strand: -

Full Sequence      

MKLPSRTALAMAAVIGCVSLSAFSAPLPAMPDPSIPVSHYITQVNPDKSITFRLFAPDAK
RVAVVLGATVDSQVSHEMRKEANGVWSWKSAPMTPDLHEYFFDVDGFRSIDTGNPYVKPQ
RQPNTSLILVPGSIIDDRAVPHGDLRTLTYHSGALKSERRVYVWTPPGYSRESEPLLVLY
FYHGFGDTGLSAITQGRIPQMMDNLLAEGKIKPMLVVIPDTETDIADAVPENFPPAERRK
DFYPINARAADKELMNDIIPLIGQRFNVRQDAQGRALAGLSQGGYQALVSGMTHLQSFGW
LASLSGVTTATVPNDDVTKQLSRADEVNSQLRNFTLVVGDKDSVTGRDIAGLKTELERDG
VKFDYHVYPGLGHEMAVWRPAYAEWVQKIF

Enzyme Prediction     

No EC number prediction in MGYG000002484_01515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	152	386	6e-41	0.9647577092511013

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	2.12e-69	77	390	2	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	2.34e-27	48	131	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	8.53e-16	152	381	1	238	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	8.22e-15	49	116	2	64	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	1.73e-08	151	319	26	198	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDT66419.1	3.80e-52	43	390	46	381
QDT36837.1	7.47e-52	28	390	28	376
QEH34939.1	3.08e-51	43	390	50	400
QRQ60217.1	5.95e-51	50	390	50	381
QDT53778.1	7.90e-48	43	390	39	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.21e-43	34	390	33	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	9.51e-39	43	390	26	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_A	1.12e-34	43	390	18	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	1.15e-34	43	390	18	343	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6NE9_A	4.42e-34	43	390	43	381	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	3.31e-182	8	390	7	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	3.68e-33	43	390	330	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	9.39e-29	30	390	383	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	5.92e-25	126	387	30	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001961	0.807121	0.189404	0.000877	0.000362	0.000247

TMHMM  Annotations     

start	end
7	29