CAZyme Information: MGYG000002485_00916

Basic Information

• Species: Fusobacterium_A mortiferum
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A mortiferum
• CAZyme ID: MGYG000002485_00916
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000002485_1|CGC15	31317.51	8.5193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002485	2635424	Isolate	not provided	not provided

• Gene Location: Start: 971329; End: 972108 Strand: +

Full Sequence      

MIPKKIHYIWLGKNSYPNLMDICINSWREKLPDYEIIEWNEENLNFYEEIEKNRFLKECY
NRKLWAFLSDYFRIKVLYEEGGVYLDTDMQIIKNIDKLLSNDFFIGAESEKVISAGIIGV
IPKHPLMKKILEFYSVAIWNEPIFTIPDIITRVINREYDFQINEDITKITGSMVIYPPRY
FYPYHFTEEFKRECIKDDTYGIHWWGKSWTQKKNLSKLYFLEFKHYRGYKKILVEILIAT
GLMRFVKNSKFLVDLSKRI

Enzyme Prediction     

No EC number prediction in MGYG000002485_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	101	2.7e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.64e-36	1	232	81	301	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.87e-15	23	104	7	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.43e-06	1	134	45	188	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	4.92e-05	18	89	133	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
cd02537	GT8_Glycogenin	4.98e-04	56	133	75	148	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19080.1	1.46e-195	1	259	1	259
AVQ28665.1	2.80e-132	1	259	1	260
SQJ00557.1	2.80e-132	1	259	1	260
BBA50716.1	1.32e-130	1	259	1	260
AVQ31609.1	3.78e-130	1	259	1	260

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9UNA3	2.25e-09	69	206	150	291	Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
Q5UQW4	1.75e-07	1	220	1	222	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
O14084	1.83e-07	2	145	64	208	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q10323	2.03e-07	2	132	57	186	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q9N289	3.28e-07	68	207	39	184	Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Pongo pygmaeus OX=9600 GN=A4GALT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002485_00916.