CAZyme Information: MGYG000002486_01783

Basic Information

• Species: Fusobacterium_A varium
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A varium
• CAZyme ID: MGYG000002486_01783
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		42991.51	9.604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002486	3346458	Isolate	not provided	not provided

• Gene Location: Start: 1904702; End: 1905790 Strand: +

Full Sequence      

MVRVRGFFIRLAGMKKKEKDIELKNIRRILIPGGRIGDMVCETPLIRELHNFFPEAEIDV
YLDKIVTPLFKNCPYLNVIETKRGSRFVHRVKILRILSSWYDALLKRKKYDLYFDFTSGL
RFYSIFALKIMKPRYSVGVFREEKHGIKKDELTIFDKYIETKKSNHMRDISLAGIEVLGK
KVENRKYELFLGETEEKYKDYFPKENINIIFNYTGGNIKKNLSIEEVKESCKKLIEINEK
IIIYVMVLPDKYEELEKEIKKWKEERIKICEKTEDILEAAAMIKYTNILVSVDTGVVHIA
SAYNIPVISIFPDNENSIEYFSPKSELSYVIKCKDRRWIKDFDKEEMKRDIKEIIDKLKW
KV

Enzyme Prediction     

No EC number prediction in MGYG000002486_01783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	104	323	3e-18	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.70e-26	26	362	1	325	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	7.58e-23	28	312	1	223	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	9.53e-05	269	311	168	209	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.08e-04	22	117	1	95	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02195	heptsyl_trn_II	2.68e-04	28	111	1	81	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH39947.1	9.49e-262	1	362	1	362
AVQ31330.1	9.49e-262	1	362	1	362
AVQ27015.1	1.04e-233	1	362	1	362
SQJ09811.1	1.04e-233	1	362	1	362
BBA50394.1	1.51e-223	1	359	1	359

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	8.20e-07	36	354	19	344	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002486_01783.