CAZyme Information: MGYG000002487_01020

Basic Information

• Species: Gordonibacter pamelaeae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Gordonibacter; Gordonibacter pamelaeae
• CAZyme ID: MGYG000002487_01020
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	MGYG000002487_3|CGC1	69289.39	6.1248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002487	3399341	Isolate	United States	North America

• Gene Location: Start: 14208; End: 16040 Strand: +

Full Sequence      

MQKVKLSNILLESGPKMDFHPDLYARSASPIIPDKDSSFAAQLMPYAKYDFGTYFNTCSC
AKYKKYTYAENFFLHLELKGSGEVRFETVSRTSLSTVRTMVGRVEFENEEFDVIEFEFPE
TSDILLAFEIVTYGTCHIKNSYYFTHVADEEVSPVRLSVAMTTFNNEKFVIPNIQLFKRE
LLSLGDEIARSLTVHVVDNGRSLDVEGLSGGGVFIHPNPNVGGSGGFARGMIESIHQKVK
PTHVLLMDDDVSVSPESIRRTYALLSIRREAYIDAFVSGAMLKLEKPNMQFEDVAYVRED
ALYDRIKPDLDMEDISDVVLNETIDVEKRNAYCAWWYCCIPMNVIEENGLPLPLFVRCDD
VEYGMRCQPTIMAMGGICVWHSAFGGRFKASIDLYQYTRNFMIATASVDPALQNIFIKRF
WDNIQLELKKFNYDSADLLLDAFEDYLRGPKFIEEVSGEDTVKRNSTKNEKLIPLSKIDF
PGVSDAAISLGEIAEDGGRTILERLVDYATFNGHRLPNVMLKDGFAVVPAGGFSYPAKRM
RMHRVLLAVDSDGKLGSLRTMDRTRFRQIMKRYKRCLGAYRSKRDAVIAEYAAAAKHLRS
EGFWKRYLGM

Enzyme Prediction     

No EC number prediction in MGYG000002487_01020.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	2.10e-09	156	366	4	201	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	9.07e-08	154	367	1	194	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd02526	GT2_RfbF_like	6.02e-05	162	368	4	187	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK44118.1	1.66e-165	1	609	1	617
AEB07220.1	6.49e-152	1	608	1	623
BAR05985.1	2.50e-150	1	610	1	622
ATO39484.1	2.57e-150	1	610	1	623
BAR06180.1	3.55e-147	1	610	1	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	6.80e-29	51	453	76	492	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R628	7.91e-31	42	485	58	516	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1
O53585	3.43e-28	51	453	56	472	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002487_01020.