CAZyme Information: MGYG000002487_01035

Basic Information

• Species: Gordonibacter pamelaeae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Gordonibacter; Gordonibacter pamelaeae
• CAZyme ID: MGYG000002487_01035
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	MGYG000002487_3|CGC2	47542.04	6.5114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002487	3399341	Isolate	United States	North America

• Gene Location: Start: 37202; End: 38512 Strand: -

Full Sequence      

MDTLTQQKKPAESAARVPKRIAVVTMGVKLGDETRGYTRFRFLSELLAREGFAVDLVTST
FQHWEKAQRDCSKPCYQGLPYRIVFIEEPGYTKNLDLGRIRSHRVAAKNLREHFAKNAGA
YDLVYAEIPPNDVARVCAEAAEAQGIPFVADINDLWPEAMRMVVDIPVVSDVAFYPFARD
AKRVYQLLSGAVGTSDEYAARPAKDRQRPYPHTTVYVGNDLAAFDAGASRFADAIEKPAD
EVWVTYAGTLGASYDVATLVRAAALLEQERLARTGAPAGPTGQAIPPVRVKVLGDGPDRE
KLQALAAELDAPADFLGYQDYEHMAAYLCASDIVVNSLVKSAAQSIVTKIGDYLASGKPM
VNTGSSPEFRSKVSADGFGVNVEAEDPRALAEEIAKLAGHASLRKIMGAKGRAVAEREFD
QPRSYRAIVDLLRTLL

Enzyme Prediction     

No EC number prediction in MGYG000002487_01035.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.15e-42	32	429	12	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	9.51e-26	38	433	18	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.09e-19	38	436	19	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03807	GT4_WbnK-like	6.76e-14	159	433	97	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
PRK10307	PRK10307	1.64e-13	220	436	204	409	colanic acid biosynthesis glycosyltransferase WcaI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS67157.1	3.58e-249	16	436	9	429
ACV55985.1	5.82e-246	26	436	1	411
BAK44128.1	6.84e-235	2	436	7	456
AJC12291.1	3.33e-188	26	435	1	406
QTU85212.1	4.44e-182	26	436	1	402

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002487_01035.