CAZyme Information: MGYG000002487_02284

Basic Information

• Species: Gordonibacter pamelaeae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Gordonibacter; Gordonibacter pamelaeae
• CAZyme ID: MGYG000002487_02284
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	MGYG000002487_7|CGC1	31025.27	6.6904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002487	3399341	Isolate	United States	North America

• Gene Location: Start: 61889; End: 62719 Strand: +

Full Sequence      

MKSVLLIGQSNMAGRGFSSEVMPICNENIFMLRNSRWQMMTEPIHFDRAVAGVGPAASFA
QAWCNANKNEQIGLIPCAEGGSSIDEWNKEGALFRHAVSEAKFAMGNSELIAILWHQGES
DGHSGKYKNYYQKLNVLINSFRKELGALEAPFIVGGLGDYLGKSGFGISCVEHDLINQEL
LKYAENNRNCYFVTGKKLYPNPDGIHINAESQRRFGIRYFEAYQTKSNIVEPLDNEANIV
KGLHEREHTVAEKRYLALERFTLGKSSMEEVMEFLK

Enzyme Prediction     

No EC number prediction in MGYG000002487_02284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	54	145	9.3e-32	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	4.43e-72	5	223	6	224	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW78361.1	1.73e-138	1	275	1	275
QLI44935.1	8.89e-132	1	275	1	275
QRF33409.1	5.12e-131	1	275	1	275
QLI78709.1	5.95e-130	1	275	1	275
QQX15784.1	2.41e-129	1	275	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	2.53e-107	1	270	2	271	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]
2APJ_A	5.82e-23	5	223	26	255	X-RayStructure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_B X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_C X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_D X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L9J9	6.12e-23	5	223	26	255	Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002487_02284.