CAZyme Information: MGYG000002487_02635

Basic Information

• Species: Gordonibacter pamelaeae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Gordonibacter; Gordonibacter pamelaeae
• CAZyme ID: MGYG000002487_02635
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000002487_9|CGC1	30318.99	6.3311

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002487	3399341	Isolate	United States	North America

• Gene Location: Start: 9541; End: 10380 Strand: -

Full Sequence      

MLGFGNARIQRALLCLLSIVRPSVLSRCYLMAMGGLLPSHLSSDLAYRKACAKLGRIYVE
TKTMCNATRNLGLDNVSIYPNCRNRPTATVLPHKTGGVLKCVSFSLIGPAKGADVILDCA
ERLAGVEFYFYGCVEETFKDAFEARVSALPNVFYHGVFDSVTNDAVSELSRYDLHLFPSK
WAAEGVPGVLVETKMAAVPTVASNIGYNAELVASGKDGIVLDECTAEAMCDAIKALDRDR
ERLVSMKEAALASAEYFCVDHYLEELVADLDNGRKGALR

Enzyme Prediction     

No EC number prediction in MGYG000002487_02635.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	9.33e-17	30	256	138	379	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	7.17e-14	107	268	201	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03823	GT4_ExpE7-like	8.32e-14	107	256	200	344	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
COG0438	RfaB	9.13e-14	102	269	203	368	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	7.75e-13	111	260	202	351	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APO34306.1	6.62e-200	1	279	59	337
APO33072.1	5.44e-199	1	279	59	337
APO33452.1	7.72e-199	1	279	59	337
APO28541.1	4.58e-80	158	279	1	122
BCS56824.1	4.12e-70	3	273	62	334

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997801	0.002222	0.000013	0.000005	0.000002	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002487_02635.