CAZyme Information: MGYG000002488_00833

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_00833
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002488_1|CGC5	40716.94	5.1331

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 673401; End: 674462 Strand: -

Full Sequence      

MEHANTEALQKNTVLQNMKRVYRYQSANQVRSVRRRSGKTRFIKDTDWERGVLWSCVSAA
WQATQDEEYLNGVLNYTLHTGFRTGPNPRFADDHVCAQAYLAISPLFEQSEVVEPTIKAF
DIMIDEPKPGREDWWWCDALFMAPPGFAALAEITNERRYLDYMHTAYWDAIDHLRDPETG
LIFRDHRYIPDGQGNELREANGEKVFWSRGIGWVLASIPRILKYMPDDYHGRERYIVLFK
ELATSILDYQHEDGFWRTSLLDPDNFPAPESSATALFCYGLAWGINQGVLEKEIYFPALN
KAWSALQTCIHDNGMIGWVQLPAFNPREVKFEHNMDYGAGAYLLAGSEVLNLL

Enzyme Prediction     

No EC number prediction in MGYG000002488_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	350	1.7e-85	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.80e-114	11	353	1	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.23e-73	47	353	28	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT33222.1	5.37e-277	1	353	1	353
QIG05302.1	7.87e-270	1	353	1	353
QKD68654.1	3.21e-269	1	353	1	353
QUT00818.1	3.21e-269	1	353	1	353
QKD73828.1	3.21e-269	1	353	1	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	5.18e-81	43	352	48	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.73e-52	90	353	114	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.18e-48	90	353	97	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	8.80e-16	136	353	200	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	3.49e-80	43	352	55	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.39e-79	43	352	53	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.34e-66	88	350	133	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	9.39e-11	47	350	30	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_00833.