CAZyme Information: MGYG000002488_01218

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_01218
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		36470.17	7.3094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 92119; End: 93069 Strand: -

Full Sequence      

MLFLRDDNKIGDMVVSTSILKQLKNNGYSVDIVSGSNNFCVIEHSNLYNKNYTYEENLFS
IIKLAFELRKEKYDLIIDMGELIPISYLLFIRIIDAKNVVGFNKANIKIYNLNINYDKYQ
SHVIERYKEMLNVLNVPFDELKYEIMIPSVIENKIKKKFINDLPYKKTVVINPFSASEKR
DISKEQLLFIMSYFKKYGVNIIFIGRQNDLENLQFKNIVGNPIGDFISASAIIKYADLVI
TPDTSIVHVATAFDKPTLALYGNDYHGQYANNYLWSPNNQKAIQITQEKIDSKVSEISTD
LIKSKLDILVGEYLCQ

Enzyme Prediction     

No EC number prediction in MGYG000002488_01218.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	63	266	1.8e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.71e-29	1	307	4	327	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	4.98e-21	2	285	3	240	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	4.58e-14	61	282	1	235	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.70e-08	11	285	17	306	lipopolysaccharide core biosynthesis protein; Provisional
cd03811	GT4_GT28_WabH-like	1.91e-04	19	206	21	196	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGW01509.1	6.36e-193	1	316	48	362
QIF91471.1	6.36e-193	1	316	48	362
AWR59971.1	1.01e-175	1	316	48	362
ARX09404.1	1.43e-175	1	316	48	362
ASB02031.1	5.82e-175	1	316	48	362

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	8.28e-32	2	306	44	348	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2
Q57336	1.43e-07	61	301	73	317	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_01218.