CAZyme Information: MGYG000002488_01511

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_01511
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000002488_3|CGC3	39375.76	5.1454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 339755; End: 340807 Strand: +

Full Sequence      

MPFVMKETQFVLDNAHSLFNHCHASTIVRVPNSERLLTAFFAGDKEGSGNTAIWLVMKEG
DHWQHAQPVVKNPGVAHWNPVLHVDPSTGNIWLFYKTGPDVHSWTTQYVISKDGGNSWSL
PSELVSGDVAPRGPVKNKVLVMSNGEWLAPGSVEDDQFWDAFVDISSDNGQHWLRVDIPI
EHHKGGQTEHEIWQGLKDDALWETDLQRVFQWDGVIQPTLWESQPGHVHAMMRSTRGTIY
RSDSTDYGRSWCPAYATILPNNNSGIDVVSFADGQLALVYNPNSGNWSRRYPISVSLSSD
NGSTWSEPFDLLDGEGEFSYPAIIAENNTLHVTFTWNRKNIVYQQLMATQ

Enzyme Prediction     

No EC number prediction in MGYG000002488_01511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	13	334	7.9e-27	0.9152046783625731

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4692	COG4692	4.93e-77	22	346	33	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13088	BNR_2	2.06e-73	35	332	2	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	7.80e-45	9	346	1	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4409	NanH	2.12e-04	222	339	577	708	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT32563.1	7.03e-276	1	350	1	350
AYY82339.1	4.07e-275	1	350	1	350
VTP78538.1	4.07e-275	1	350	1	350
QQP27163.1	3.35e-274	1	350	1	350
QPB81156.1	3.35e-274	1	350	1	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_01511.