CAZyme Information: MGYG000002488_01859

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_01859
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000002488_3|CGC5	36143.32	9.6865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 606271; End: 607203 Strand: -

Full Sequence      

MRVDFVERYKWFLLFIFIFLTYFIPLETRLLWQPDEIRYAEISREMLVSGNWSVPYMLDI
RYFEKPVLGYWLNSIAQWLFGEGNFSVRIVVVTSTLLTGLFVYRAAMLVWHNRNLAFNAL
VVFLSSFLVLAIGTYNILDPIVTMFVTIAMYYFLRGLSAQNRKSKISAYILVGVFCGLGF
LTKGFIAVVLPALVFVVTAISLSRFKEVLCYALIALISMLIIAGPWVISVALQASDYWHY
FFWIEHVQRFVEKGAARSQPMWFYLPIIILGILPWLGFLFGAIKSAILLKKGTLYFSFWF
FLFFFFFFCL

Enzyme Prediction     

No EC number prediction in MGYG000002488_01859.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	308	2.8e-87	0.5481481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	5.58e-144	7	286	4	283	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	8.37e-43	10	284	8	283	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	1.26e-18	12	241	6	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	2.34e-12	65	228	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	0.005	12	263	30	285	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNH66488.1	2.48e-202	1	299	1	299
ATN01514.1	2.71e-199	1	299	1	299
QQP24706.1	7.74e-199	1	299	1	299
QPB78699.1	7.74e-199	1	299	1	299
QJW50189.1	1.80e-197	1	299	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.18e-29	11	277	33	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4EUL1	8.23e-163	1	299	1	299	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	8.06e-100	12	286	12	286	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B4ETL9	1.43e-97	13	286	13	286	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
A1JPM4	1.44e-94	13	283	11	281	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
B2VBI7	3.95e-94	16	299	12	298	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000003	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
86	108
115	137
141	158
171	193
208	230
260	282
292	309