CAZyme Information: MGYG000002488_02833

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_02833
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
159		17658.87	9.108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 17738; End: 18217 Strand: -

Full Sequence      

MSGQLSTTQCPLVIGLVAGETSGDILGAGLIRALKKMHPNVHFVGVAGPLMQAEGCEAWY
EMEELAVMGIVEVLERLPRLLKIRKDLTQRFSELKPDVFVGIDAPDFNITLEGRLKQKGI
KTIHYVSPSVWAWRQKRVFKIGKATDLVLAFLPFEKSVL

Enzyme Prediction     

No EC number prediction in MGYG000002488_02833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	14	158	1.9e-64	0.4067796610169492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.26e-97	11	156	1	146	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.17e-80	11	156	1	148	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
TIGR00215	lpxB	1.61e-76	14	156	8	150	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	1.54e-72	14	156	1	145	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	3.91e-38	16	156	231	373	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT33016.1	5.62e-108	1	157	3	159
QHN11649.1	3.71e-106	1	157	3	159
QNH65136.1	2.12e-105	1	157	3	159
ATM99607.1	8.58e-105	1	157	3	159
QQP26649.1	2.45e-104	1	157	3	159

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.02e-82	7	157	2	152	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.02e-82	7	157	2	152	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZH55	5.10e-93	11	157	17	163	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q667K2	5.10e-93	11	157	17	163	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
Q7N8N4	2.02e-91	11	157	12	158	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
A8GID3	4.66e-91	11	157	5	151	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
P72216	5.54e-91	1	139	3	141	Lipid-A-disaccharide synthase (Fragment) OS=Proteus mirabilis OX=584 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_02833.