CAZyme Information: MGYG000002488_03716

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_03716
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		63648.82	6.4271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 298923; End: 300566 Strand: -

Full Sequence      

MIAVAFAIFYKEKGTYQRLNTPWSETIIYEGHVKGLTKLHPEIPENLQGTYAALGHPAFI
SHLKKLGITALELLPIQYHLTEPHLHKIGLKNYWGYNVLAPFALSTQYYSNLGQNIIDEF
REAVRCLHKANIEVILDVVFNHTAELSDQFEGYIVSQRGIDNQSYYWLNDENKAQNWTGC
GNTLNLNRPETVQWVMDCLRYWVTEFHIDGFRFDLATSLGRVPYFDTQSPLLTAIRQDPL
LSRIKLIAEPWDLGSDGYQVGNFPVPFTEWNDSYRDVIRRFWLWRDVSIATFADNITGSA
KLYHKNGRPPYSSINMITSHDGFTLRDLVSYQNKHNEENGESNLDGHNTNYSVNFGEEGL
IVNEKTNQHRLLATRNMLATLLFSRGTPHLLAGDEVGNTQYGNNNAYCQDNKVSWIKWFK
RPYNLTDYIHHLIKLRHQITPLSSFKWWEEDSQNIIWLNQNAQPMSHEDWQQLPPSPLQL
LFAEQWILMFNPLRNSIVFSLPEGYWSCLLDTTSWPDCHPAQFEHCEVQPNSITLWRKRG
FLYSVFY

Enzyme Prediction     

EC	3.2.1.68	3.2.1.-	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	48	399	6.3e-147	0.9971509971509972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02100	glgX_debranch	0.0	17	538	147	688	glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1523	PulA	0.0	17	539	163	692	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
PRK03705	PRK03705	0.0	20	506	145	627	glycogen debranching protein GlgX.
cd11326	AmyAc_Glg_debranch	0.0	14	439	4	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14510	PRK14510	5.03e-147	19	482	152	618	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT34015.1	0.0	6	541	137	672
QNH67328.1	0.0	10	541	141	672
ATN00548.1	0.0	10	547	141	673
QIG06115.1	0.0	10	547	141	673
QQP25603.1	0.0	6	547	137	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WSK_A	6.27e-185	21	509	146	630	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
2VNC_A	4.81e-130	22	512	170	685	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	3.31e-90	19	513	217	781	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
1BF2_A	6.82e-60	25	517	178	716	StructureOf Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
2WAN_A	1.10e-30	13	507	420	889	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WFL4	2.96e-193	22	509	147	630	Glycogen debranching enzyme OS=Enterobacter sp. (strain 638) OX=399742 GN=glgX PE=3 SV=1
Q6CZK1	6.13e-193	17	517	142	639	Glycogen debranching enzyme OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=glgX PE=3 SV=1
C6DH78	9.92e-192	17	517	142	639	Glycogen debranching enzyme OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=glgX PE=3 SV=1
A6TF50	6.46e-190	21	506	146	627	Glycogen debranching enzyme OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=glgX PE=3 SV=1
A8GKU9	2.02e-189	21	513	146	636	Glycogen debranching enzyme OS=Serratia proteamaculans (strain 568) OX=399741 GN=glgX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_03716.