CAZyme Information: MGYG000002488_04032

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_04032
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191	MGYG000002488_5|CGC6	21490.5	10.077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 549794; End: 550369 Strand: -

Full Sequence      

MLINQFKKTHLDFLSQKPINSRINNASISTAQWKATPFDNHIQQASSRYNVDETLIKAII
QVESNFRPEVISKSNAVGLMQIKASTAGRDVYQNRGKAGQPTTAQLKDPAINIDLGTAYI
QLLRERHLVGIADPETLYYATILAYVNGAGALLRTFDKNRDNAIAKINSMSADDFYRYVE
KTIRQLKHHVI

Enzyme Prediction     

No EC number prediction in MGYG000002488_04032.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	182	1.2e-18	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	3.75e-67	42	181	3	143	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	9.99e-57	43	181	44	182	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	4.27e-52	42	177	196	331	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	4.85e-28	42	167	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	2.28e-23	42	126	8	90	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT34212.1	2.20e-116	13	181	32	200
QPN89255.1	4.24e-114	13	181	32	200
QIF93810.1	6.03e-114	13	181	32	200
QHN10463.1	9.97e-113	13	181	32	200
QNH64416.1	9.97e-113	13	181	32	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	1.95e-47	43	181	27	165	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHZ_A	1.95e-47	43	181	27	165	Structureof Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12],6GHZ_B Structure of Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12]
3T36_A	2.55e-47	43	181	44	182	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	5.55e-47	43	181	27	165	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	5.55e-47	43	181	27	165	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LSJ1	5.35e-49	43	181	44	182	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
B7UQ77	6.97e-47	43	181	44	182	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=emtA PE=3 SV=1
B7MTX1	1.40e-46	43	181	44	182	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O81 (strain ED1a) OX=585397 GN=emtA PE=3 SV=1
B7NUV4	1.40e-46	43	181	44	182	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=emtA PE=3 SV=1
B7MK90	1.40e-46	43	181	44	182	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) OX=585035 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_04032.