CAZyme Information: MGYG000002489_00940

Basic Information

• Species: Neisseria gonorrhoeae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria gonorrhoeae
• CAZyme ID: MGYG000002489_00940
• CAZy Family: GT25
• CAZyme Description: Lipooligosaccharide biosynthesis protein lex-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280	MGYG000002489_6|CGC1	32440.57	8.632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002489	2153911	Isolate	Canada	North America

• Gene Location: Start: 56138; End: 56980 Strand: -

Full Sequence      

MQNHVISLASAAERRAHIAATFGSRGIPFQFFDALMPSERLEQAMAELVPGLSAHPYLSG
VEKACFMSHAVLWKQALDEGLPYIAVFEDDVLFGKDAEKFLAEDTWLEERFDKDSAFIVR
LETMFAKVIVRPDKVLNYENRSFPLLESEHCGTAGYIISREAMRFFLDRFAVLPAERIKA
VDLMMFTYFFDKEGMPVYQVSPALCTQELHYAKFLSQNSMLGSDLEKDREQGRRHRRSLK
VMFDLKRALGKFGREKKKRMERQRQAELEKVYGRRVILFK

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	185	4e-36	0.9834254143646409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3306	COG3306	2.65e-82	1	265	3	255	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	5.58e-61	2	185	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	8.96e-31	2	185	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV87691.1	9.86e-200	1	280	1	280
BCD78615.1	9.86e-200	1	280	1	280
BCD74162.1	9.86e-200	1	280	1	280
SNU92338.1	9.86e-200	1	280	1	280
SBO76859.1	9.86e-200	1	280	1	280

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50950	6.07e-195	1	280	1	280	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria gonorrhoeae OX=485 GN=lgtE PE=3 SV=1
Q51117	4.49e-181	1	280	1	280	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtE PE=3 SV=2
Q50947	8.49e-135	1	265	1	269	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria gonorrhoeae OX=485 GN=lgtB PE=3 SV=1
Q51116	2.84e-132	1	265	1	269	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lgtB PE=3 SV=2
P57033	4.85e-127	1	265	1	269	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtB OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lgtB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002489_00940.